Details of the Target

General Information of Target

Target ID LDTP11166
Target Name Cerebral cavernous malformations 2 protein (CCM2)
Gene Name CCM2
Gene ID 83605
Synonyms
C7orf22; Cerebral cavernous malformations 2 protein; Malcavernin
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGK
DKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSR
WFGKPSPLLLQYSVKEKRR
Target Bioclass
Other
Family
CCM2 family
Subcellular location
Cytoplasm
Function
Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity. May act through the stabilization of endothelial cell junctions. May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock.
Uniprot ID
Q9BSQ5
Ensemble ID
ENST00000258781.11
HGNC ID
HGNC:21708

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1 SNV: p.R404M .
IGROV1 SNV: p.R326H .
KYSE30 Deletion: p.K35RfsTer2 .
MEWO Substitution: p.P165F .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
IA-alkyne
 Probe Info  		C437(1.38)  LDD0304  [2]
DBIA
 Probe Info  		C191(2.66)  LDD3318  [3]
NAIA_4
 Probe Info  		N.A.  LDD2226  [4]
TFBX
 Probe Info  		N.A.  LDD0027  [5]
IPM
 Probe Info  		N.A.  LDD2156  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 13.80  LDD0403  [1]
 LDCM0625  F8 Ramos C170(1.67)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C170(1.55); C437(0.83)  LDD2189  [7]
 LDCM0573  Fragment11 Ramos C170(7.53)  LDD2190  [7]
 LDCM0574  Fragment12 Ramos C170(0.94); C437(0.34)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C170(0.92); C437(0.66)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos C170(0.87)  LDD2193  [7]
 LDCM0579  Fragment20 Ramos C170(0.99)  LDD2194  [7]
 LDCM0580  Fragment21 Ramos C170(0.90); C437(0.90)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C170(1.03); C437(1.02)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C170(0.94); C437(0.63)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos C170(0.71)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C170(1.00)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C170(1.07); C437(0.45)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C170(1.43); C437(0.51)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C170(1.18); C437(1.03)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C170(0.84); C437(0.42)  LDD2203  [7]
 LDCM0566  Fragment4 Ramos C170(0.94)  LDD2184  [7]
 LDCM0610  Fragment52 Ramos C170(1.47)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C170(1.38)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos C170(1.38); C437(2.54)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C170(1.47)  LDD2188  [7]
 LDCM0022  KB02 Ramos C170(1.74)  LDD2182  [7]
 LDCM0023  KB03 Ramos C170(1.23)  LDD2183  [7]
 LDCM0024  KB05 MELHO C191(2.66)  LDD3318  [3]
 LDCM0131  RA190 MM1.R C437(1.38)  LDD0304  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Mitogen-activated protein kinase kinase kinase 3 (MAP3K3) STE Ser/Thr protein kinase family Q99759
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Twist-related protein 2 (TWIST2) . Q8WVJ9
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
V-set and transmembrane domain-containing protein 2-like protein (VSTM2L) . Q96N03
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Docking protein 4 (DOK4) DOK family, Type B subfamily Q8TEW6
Programmed cell death protein 10 (PDCD10) PDCD10 family Q9BUL8
Ras and Rab interactor 1 (RIN1) RIN (Ras interaction/interference) family Q13671
Krev interaction trapped protein 1 (KRIT1) . O00522
Talin rod domain-containing protein 1 (TLNRD1) . Q9H1K6

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
3 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578