Details of the Target

General Information of Target

Target ID LDTP11125
Target Name Zinc finger protein with KRAB and SCAN domains 3 (ZKSCAN3)
Gene Name ZKSCAN3
Gene ID 80317
Synonyms
ZFP47; ZNF306; ZNF309; ZSCAN13; Zinc finger protein with KRAB and SCAN domains 3; Zinc finger and SCAN domain-containing protein 13; Zinc finger protein 306; Zinc finger protein 309; Zinc finger protein 47 homolog; Zf47; Zfp-47
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function
Transcriptional factor that binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. Associates with chromatin at the ITGB4 and VEGF promoters. Also acts as a transcription activator and promotes cancer cell progression and/or migration in various tumors and myelomas.
Uniprot ID
Q9BRR0
Ensemble ID
ENST00000252211.7
HGNC ID
HGNC:13853

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HDMYZ SNV: p.Q287R .
HDQP1 SNV: p.V117L .
MEWO Substitution: p.Q178Ter .
NCIH2172 SNV: p.G235V .
OCIAML5 SNV: p.W463Ter .
ONS76 SNV: p.G432S .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C195(0.90); C196(0.90)  LDD0078  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C291(1.01)  LDD1508  [2]
 LDCM0237  AC12 HEK-293T C411(0.93)  LDD1510  [2]
 LDCM0277  AC18 HEK-293T C291(0.89)  LDD1516  [2]
 LDCM0279  AC2 HEK-293T C291(0.96)  LDD1518  [2]
 LDCM0280  AC20 HEK-293T C411(0.89)  LDD1519  [2]
 LDCM0286  AC26 HEK-293T C291(0.86)  LDD1525  [2]
 LDCM0288  AC28 HEK-293T C411(0.78)  LDD1527  [2]
 LDCM0295  AC34 HEK-293T C291(0.99)  LDD1534  [2]
 LDCM0297  AC36 HEK-293T C411(1.31)  LDD1536  [2]
 LDCM0301  AC4 HEK-293T C411(0.65)  LDD1540  [2]
 LDCM0304  AC42 HEK-293T C291(0.94)  LDD1543  [2]
 LDCM0306  AC44 HEK-293T C411(1.09)  LDD1545  [2]
 LDCM0313  AC50 HEK-293T C291(0.98)  LDD1552  [2]
 LDCM0315  AC52 HEK-293T C411(1.36)  LDD1554  [2]
 LDCM0321  AC58 HEK-293T C291(1.11)  LDD1560  [2]
 LDCM0324  AC60 HEK-293T C411(1.10)  LDD1563  [2]
 LDCM0020  ARS-1620 HCC44 C195(0.90); C196(0.90)  LDD0078  [1]
 LDCM0405  CL18 HEK-293T C291(1.03)  LDD1609  [2]
 LDCM0408  CL20 HEK-293T C411(0.94)  LDD1612  [2]
 LDCM0419  CL30 HEK-293T C291(0.90)  LDD1623  [2]
 LDCM0421  CL32 HEK-293T C411(0.80)  LDD1625  [2]
 LDCM0432  CL42 HEK-293T C291(1.00)  LDD1636  [2]
 LDCM0434  CL44 HEK-293T C411(1.14)  LDD1638  [2]
 LDCM0445  CL54 HEK-293T C291(0.96)  LDD1648  [2]
 LDCM0447  CL56 HEK-293T C411(0.80)  LDD1650  [2]
 LDCM0451  CL6 HEK-293T C291(1.08)  LDD1654  [2]
 LDCM0458  CL66 HEK-293T C291(0.87)  LDD1661  [2]
 LDCM0460  CL68 HEK-293T C411(0.78)  LDD1663  [2]
 LDCM0471  CL78 HEK-293T C291(1.09)  LDD1674  [2]
 LDCM0473  CL8 HEK-293T C411(0.84)  LDD1676  [2]
 LDCM0474  CL80 HEK-293T C411(0.84)  LDD1677  [2]
 LDCM0485  CL90 HEK-293T C291(1.13)  LDD1688  [2]
 LDCM0487  CL92 HEK-293T C411(0.67)  LDD1690  [2]
 LDCM0022  KB02 HCT 116 C195(4.55); C196(4.55)  LDD0080  [1]
 LDCM0023  KB03 HCT 116 C195(2.14); C196(2.14)  LDD0081  [1]
 LDCM0024  KB05 HCT 116 C195(5.10); C196(5.10)  LDD0082  [1]
 LDCM0021  THZ1 HCT 116 C195(1.10); C196(1.10)  LDD2173  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine--tRNA ligase, cytoplasmic (SARS1) Class-II aminoacyl-tRNA synthetase family P49591
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Eukaryotic translation initiation factor 2 subunit 3 (EIF2S3) Classic translation factor GTPase family P41091
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Heat shock-related 70 kDa protein 2 (HSPA2) Heat shock protein 70 family P54652
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Protein Mdm4 (MDM4) MDM2/MDM4 family O15151
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
SCAN domain-containing protein 1 (SCAND1) . P57086

References

1 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402