Details of the Target
General Information of Target
| Target ID | LDTP11000 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H2B type 1-M (H2BC14) | |||||
| Gene Name | H2BC14 | |||||
| Gene ID | 8342 | |||||
| Synonyms |
H2BFE; HIST1H2BM; Histone H2B type 1-M; Histone H2B.e; H2B/e |
|||||
| 3D Structure | ||||||
| Sequence |
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKTK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H2B family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-4 Probe Info |
![]() |
100.00 | LDD0445 | [2] | |
|
STPyne Probe Info |
![]() |
K21(2.63); K6(6.06) | LDD0277 | [3] | |
|
HHS-475 Probe Info |
![]() |
Y84(1.13) | LDD0264 | [4] | |
|
HHS-465 Probe Info |
![]() |
Y84(2.95) | LDD2237 | [5] | |
Competitor(s) Related to This Target
References




