Details of the Target

General Information of Target

Target ID LDTP10861
Target Name Protein kinase C-binding protein NELL2 (NELL2)
Gene Name NELL2
Gene ID 4753
Synonyms
NRP2; Protein kinase C-binding protein NELL2; NEL-like protein 2; Nel-related protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVD
DKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDT
VRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVM
YVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYG
LDEI
Target Bioclass
Other
Subcellular location
Secreted
Function
Plays multiple roles in neural tissues, regulates neuronal proliferation, survival, differentiation, polarization, as well as axon guidance and synaptic functions. Plays an important role in axon development during neuronal differentiation through the MAPK intracellular signaling pathway. Via binding to its receptor ROBO3, plays a role in axon guidance, functioning as a repulsive axon guidance cue that contributes to commissural axon guidance to the midline. Required for neuron survival through the modulation of MAPK signaling pathways too. Involved in the regulation of hypothalamic GNRH secretion and the control of puberty.; Epididymal-secreted protein that signals through a ROS1-pathway to regulate the epididymal initial segment (IS) maturation, sperm maturation and male fertility.
Uniprot ID
Q99435
Ensemble ID
ENST00000333837.8
HGNC ID
HGNC:7751

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A101D SNV: p.H235Y .
GB1 SNV: p.C812Y .
HCT15 SNV: p.T348A; p.P733S .
HS936T SNV: p.R754P .
HUH7 SNV: p.V509F .
Ishikawa (Heraklio) 02 ER Deletion: p.C679Ter .
MEWO SNV: p.D763N .
MFE319 SNV: p.S698N .
NCIH2291 SNV: p.G216Ter .
OCUM1 SNV: p.C291S .
RH30 SNV: p.I67V .
RL952 SNV: p.C566F .
SNU308 SNV: p.D148N .
SUDHL6 SNV: p.D775H .
TE10 SNV: p.D685H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C413(1.18)  LDD1510  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0167  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C413(1.18)  LDD1510  [1]
 LDCM0280  AC20 HEK-293T C413(1.09)  LDD1519  [1]
 LDCM0288  AC28 HEK-293T C413(1.05)  LDD1527  [1]
 LDCM0297  AC36 HEK-293T C413(1.08)  LDD1536  [1]
 LDCM0301  AC4 HEK-293T C413(0.90)  LDD1540  [1]
 LDCM0306  AC44 HEK-293T C413(1.24)  LDD1545  [1]
 LDCM0315  AC52 HEK-293T C413(1.34)  LDD1554  [1]
 LDCM0324  AC60 HEK-293T C413(0.98)  LDD1563  [1]
 LDCM0408  CL20 HEK-293T C413(1.19)  LDD1612  [1]
 LDCM0421  CL32 HEK-293T C413(1.22)  LDD1625  [1]
 LDCM0434  CL44 HEK-293T C413(1.22)  LDD1638  [1]
 LDCM0447  CL56 HEK-293T C413(1.18)  LDD1650  [1]
 LDCM0460  CL68 HEK-293T C413(1.10)  LDD1663  [1]
 LDCM0473  CL8 HEK-293T C413(1.06)  LDD1676  [1]
 LDCM0474  CL80 HEK-293T C413(1.15)  LDD1677  [1]
 LDCM0487  CL92 HEK-293T C413(1.15)  LDD1690  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
TGF-beta receptor type-2 (TGFBR2) TKL Ser/Thr protein kinase family P37173
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) . Q9BYB0
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Methyl-CpG-binding domain protein 1 (MBD1) . Q9UIS9
Zinc finger protein Gfi-1b (GFI1B) . Q5VTD9
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Roundabout homolog 3 (ROBO3) ROBO family Q96MS0
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
FMR1-interacting protein NUFIP2 (NUFIP2) . Q7Z417

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060