Details of the Target
General Information of Target
| Target ID | LDTP10861 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein kinase C-binding protein NELL2 (NELL2) | |||||
| Gene Name | NELL2 | |||||
| Gene ID | 4753 | |||||
| Synonyms |
NRP2; Protein kinase C-binding protein NELL2; NEL-like protein 2; Nel-related protein 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVD
DKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDT VRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVM YVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYG LDEI |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Plays multiple roles in neural tissues, regulates neuronal proliferation, survival, differentiation, polarization, as well as axon guidance and synaptic functions. Plays an important role in axon development during neuronal differentiation through the MAPK intracellular signaling pathway. Via binding to its receptor ROBO3, plays a role in axon guidance, functioning as a repulsive axon guidance cue that contributes to commissural axon guidance to the midline. Required for neuron survival through the modulation of MAPK signaling pathways too. Involved in the regulation of hypothalamic GNRH secretion and the control of puberty.; Epididymal-secreted protein that signals through a ROS1-pathway to regulate the epididymal initial segment (IS) maturation, sperm maturation and male fertility.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C413(1.18) | LDD1510 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0167 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0237 | AC12 | HEK-293T | C413(1.18) | LDD1510 | [1] |
| LDCM0280 | AC20 | HEK-293T | C413(1.09) | LDD1519 | [1] |
| LDCM0288 | AC28 | HEK-293T | C413(1.05) | LDD1527 | [1] |
| LDCM0297 | AC36 | HEK-293T | C413(1.08) | LDD1536 | [1] |
| LDCM0301 | AC4 | HEK-293T | C413(0.90) | LDD1540 | [1] |
| LDCM0306 | AC44 | HEK-293T | C413(1.24) | LDD1545 | [1] |
| LDCM0315 | AC52 | HEK-293T | C413(1.34) | LDD1554 | [1] |
| LDCM0324 | AC60 | HEK-293T | C413(0.98) | LDD1563 | [1] |
| LDCM0408 | CL20 | HEK-293T | C413(1.19) | LDD1612 | [1] |
| LDCM0421 | CL32 | HEK-293T | C413(1.22) | LDD1625 | [1] |
| LDCM0434 | CL44 | HEK-293T | C413(1.22) | LDD1638 | [1] |
| LDCM0447 | CL56 | HEK-293T | C413(1.18) | LDD1650 | [1] |
| LDCM0460 | CL68 | HEK-293T | C413(1.10) | LDD1663 | [1] |
| LDCM0473 | CL8 | HEK-293T | C413(1.06) | LDD1676 | [1] |
| LDCM0474 | CL80 | HEK-293T | C413(1.15) | LDD1677 | [1] |
| LDCM0487 | CL92 | HEK-293T | C413(1.15) | LDD1690 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| TGF-beta receptor type-2 (TGFBR2) | TKL Ser/Thr protein kinase family | P37173 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| SH3 and multiple ankyrin repeat domains protein 3 (SHANK3) | . | Q9BYB0 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Homeobox protein Hox-A1 (HOXA1) | Antp homeobox family | P49639 | |||
| Methyl-CpG-binding domain protein 1 (MBD1) | . | Q9UIS9 | |||
| Zinc finger protein Gfi-1b (GFI1B) | . | Q5VTD9 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Roundabout homolog 3 (ROBO3) | ROBO family | Q96MS0 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| FMR1-interacting protein NUFIP2 (NUFIP2) | . | Q7Z417 | |||
References


