Details of the Target
General Information of Target
| Target ID | LDTP10758 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sorting nexin-18 (SNX18) | |||||
| Gene Name | SNX18 | |||||
| Gene ID | 112574 | |||||
| Synonyms |
SH3PXD3B; Sorting nexin-18; SH3 and PX domain-containing protein 3B |
|||||
| 3D Structure | ||||||
| Sequence |
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKL
EQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGS LCSILKVCQGDGQLQRFLENQDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDIS IQRFHKYDAFKKNLKPNIDLPSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIP FDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG ACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGEKPYECSECGK AFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQL IIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQ RIHTGEKPYICAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT VVKS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Sorting nexin family
|
|||||
| Subcellular location |
Endomembrane system
|
|||||
| Function |
Involved in endocytosis and intracellular vesicle trafficking, both during interphase and at the end of mitosis. Required for efficient progress through mitosis and cytokinesis. Required for normal formation of the cleavage furrow at the end of mitosis. Plays a role in endocytosis via clathrin-coated pits, but also clathrin-independent, actin-dependent fluid-phase endocytosis. Plays a role in macropinocytosis. Binds to membranes enriched in phosphatidylinositol 4,5-bisphosphate and promotes membrane tubulation. Stimulates the GTPase activity of DNM2. Promotes DNM2 location at the plasma membrane. Together with DNM2, involved in autophagosome assembly by regulating trafficking from recycling endosomes of phospholipid scramblase ATG9A.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K432(6.25) | LDD0277 | [1] | |
|
AHL-Pu-1 Probe Info |
![]() |
C30(2.62) | LDD0171 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y55(1.01) | LDD0264 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [5] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C30(2.62) | LDD0171 | [2] |
| LDCM0116 | HHS-0101 | DM93 | Y55(1.01) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y55(0.97) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y55(0.91) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y55(0.98) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y55(0.92) | LDD0268 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| MyoD family inhibitor (MDFI) | MDFI family | Q99750 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger and BTB domain-containing protein 42 (ZBTB42) | Krueppel C2H2-type zinc-finger protein family | B2RXF5 | |||
Other
References






