Details of the Target
General Information of Target
Target ID | LDTP10681 | |||||
---|---|---|---|---|---|---|
Target Name | NADPH oxidase 5 (NOX5) | |||||
Gene Name | NOX5 | |||||
Gene ID | 79400 | |||||
Synonyms |
NADPH oxidase 5; EC 1.6.3.- |
|||||
3D Structure | ||||||
Sequence |
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS GGRPLPPPDTLASAGDFLCTM |
|||||
Target Bioclass |
Enzyme
|
|||||
Subcellular location |
Membrane; Endoplasmic reticulum
|
|||||
Function |
Calcium-dependent NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor. May play a role in cell growth and apoptosis.; [Isoform v2]: Calcium-dependent NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor. Also functions as a calcium-dependent proton channel and may regulate redox-dependent processes in lymphocytes and spermatozoa. Involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.; [Isoform v1]: Calcium-dependent NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor.; [Isoform v5]: Calcium-dependent NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor. According tolacks enzyme activity. Involved in endothelial generation of reactive oxygen species (ROS), proliferation and angiogenesis and contribute to endothelial response to thrombin.; [Isoform v4]: Lacks calcium-dependent NADPH oxidase activity.; [Isoform v3]: Lacks calcium-dependent NADPH oxidase activity.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
YN-1 Probe Info |
![]() |
N.A. | LDD0446 | [1] |