Details of the Target
General Information of Target
| Target ID | LDTP10584 | |||||
|---|---|---|---|---|---|---|
| Target Name | Junctional sarcoplasmic reticulum protein 1 (JSRP1) | |||||
| Gene Name | JSRP1 | |||||
| Gene ID | 126306 | |||||
| Synonyms |
JP45; Junctional sarcoplasmic reticulum protein 1; Junctional-face membrane protein of 45 kDa homolog; JP-45 |
|||||
| 3D Structure | ||||||
| Sequence |
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYS
MDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADF QNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPV KNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNK KRHRHSE |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Sarcoplasmic reticulum membrane
|
|||||
| Function |
Involved in skeletal muscle excitation/contraction coupling (EC), probably acting as a regulator of the voltage-sensitive calcium channel CACNA1S. EC is a physiological process whereby an electrical signal (depolarization of the plasma membrane) is converted into a chemical signal, a calcium gradient, by the opening of ryanodine receptor calcium release channels. May regulate CACNA1S membrane targeting and activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C18(1.10) | LDD0304 | [1] | |
|
DBIA Probe Info |
![]() |
C18(0.98) | LDD3404 | [2] | |
|
Alkyne-RA190 Probe Info |
![]() |
5.70 | LDD0299 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Phosphatidate cytidylyltransferase 2 (CDS2) | CDS family | O95674 | |||
Transporter and channel
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Syntaxin-8 (STX8) | Syntaxin family | Q9UNK0 | |||
| Ubiquilin-1 (UBQLN1) | . | Q9UMX0 | |||
References



