Details of the Target

General Information of Target

Target ID LDTP10400
Target Name MORF4 family-associated protein 1-like 1 (MRFAP1L1)
Gene Name MRFAP1L1
Gene ID 114932
Synonyms
MORF4 family-associated protein 1-like 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDP
NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTL
TPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR
ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
Target Bioclass
Other
Family
MORF4 family-associated protein family
Uniprot ID
Q96HT8
Ensemble ID
ENST00000320848.7
HGNC ID
HGNC:28796

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Jackson_1
 Probe Info  		20.00  LDD0121  [1]
DBIA
 Probe Info  		C97(52.48)  LDD0209  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0071  Cisar_cp14 MDA-MB-231 20.00  LDD0121  [1]
 LDCM0023  KB03 Jurkat C97(52.48)  LDD0209  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Presenilin-2 (PSEN2) Peptidase A22A family P49810
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Mitogen-activated protein kinase 3 (MAPK3) CMGC Ser/Thr protein kinase family P27361
Ribose-phosphate pyrophosphokinase 1 (PRPS1) Ribose-phosphate pyrophosphokinase family P60891
GTPase HRas (HRAS) Ras family P01112
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Ubiquitin domain-containing protein 1 (UBTD1) . Q9HAC8
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Complex I assembly factor TMEM126B, mitochondrial (TMEM126B) TMEM126 family Q8IUX1
Syntenin-1 (SDCBP) . O00560
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
General transcription factor II-I repeat domain-containing protein 1 (GTF2IRD1) TFII-I family Q9UHL9
Homeobox protein MOX-2 (MEOX2) . P50222
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Transcription factor 4 (TCF4) . P15884
Other
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Abl interactor 2 (ABI2) ABI family Q9NYB9
Ataxin-1 (ATXN1) ATXN1 family P54253
Bystin (BYSL) Bystin family Q13895
Caveolae-associated protein 3 (CAVIN3) CAVIN family Q969G5
Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) CDK2AP family O14519
Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2) CDK2AP family O75956
Centromere protein K (CENPK) CENP-K/MCM22 family Q9BS16
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
MORF4 family-associated protein 1 (MRFAP1) MORF4 family-associated protein family Q9Y605
MORF4 family-associated protein 1-like 1 (MRFAP1L1) MORF4 family-associated protein family Q96HT8
Phosphatidylinositol 3-kinase regulatory subunit beta (PIK3R2) PI3K p85 subunit family O00459
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Ras-associating and dilute domain-containing protein (RADIL) RADIL family Q96JH8
Swi5-dependent recombination DNA repair protein 1 homolog (SFR1) SFR1/MEI5 family Q86XK3
Synaptonemal complex central element protein 1 (SYCE1) SYCE family Q8N0S2
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
WD40 repeat-containing protein SMU1 (SMU1) WD repeat SMU1 family Q2TAY7
Cancer-associated gene 1 protein (CAGE1) . Q8TC20
Centrosomal protein of 44 kDa (CEP44) . Q9C0F1
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
Ligand of Numb protein X 2 (LNX2) . Q8N448
Mortality factor 4-like protein 1 (MORF4L1) . Q9UBU8
Mortality factor 4-like protein 2 (MORF4L2) . Q15014
RAD52 motif-containing protein 1 (RDM1) . Q8NG50
Rhombotin-2 (LMO2) . P25791
Uncharacterized protein C3orf62 (C3orf62) . Q6ZUJ4

References

1 Appendage and Scaffold Diverse Fully Functionalized Small-Molecule Probes via a Minimalist Terminal Alkyne-Aliphatic Diazirine Isocyanide. J Org Chem. 2018 Sep 21;83(18):11245-11253. doi: 10.1021/acs.joc.8b01831. Epub 2018 Aug 31.
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.