Details of the Target
General Information of Target
| Target ID | LDTP10306 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endonuclease 8-like 1 (NEIL1) | |||||
| Gene Name | NEIL1 | |||||
| Gene ID | 79661 | |||||
| Synonyms |
Endonuclease 8-like 1; EC 3.2.2.-; EC 4.2.99.18; DNA glycosylase/AP lyase Neil1; DNA-(apurinic or apyrimidinic site) lyase Neil1; Endonuclease VIII-like 1; FPG1; Nei homolog 1; NEH1; Nei-like protein 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MNEKSCSFHSKEELRDGQGERLSAGYSPSYDKDKSVLAFRGIPISELKNHGILQALTTEA
YEWEPRVVSTEVVRAQEEWEAVDTIQPETGSQASSEQPGQLISFSEALQHFQTVDLSPFK KRIQPTIRRTGLAALRHYLFGPPKLHQRLREERDLVLTIAQCGLDSQDPVHGRVLQTIYK KLTGSKFDCALHGNHWEDLGFQGANPATDLRGAGFLALLHLLYLVMDSKTLPMAQEIFRL SRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSFYAATFLHLAHVWR TQRKTISDSGFVLKELEVLAKKSPRRLLKTLELYLARVSKGQASLLGAQKCYGPEAPPFK DLTFTGESDLQSHSSEGVWLI |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
FPG family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
|
|||||
| Function |
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as a DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, formamidopyrimidine (Fapy) and 5-hydroxyuracil. Has marginal activity towards 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Has DNA glycosylase/lyase activity towards mismatched uracil and thymine, in particular in U:C and T:C mismatches. Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C26(1.88) | LDD3339 | [1] | |
|
IA-alkyne Probe Info |
 |
C162(0.55); C26(0.43) | LDD2182 | [2] | |
|
W1 Probe Info |
 |
K155(0.00); D154(0.00); N151(0.00); R150(0.00) | LDD0236 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C162(0.84); C26(1.14) | LDD2187 | [2] |
| LDCM0572 | Fragment10 | Ramos | C162(0.60) | LDD2189 | [2] |
| LDCM0573 | Fragment11 | Ramos | C162(2.90); C26(11.70); C370(7.56) | LDD2190 | [2] |
| LDCM0574 | Fragment12 | Ramos | C162(0.83) | LDD2191 | [2] |
| LDCM0575 | Fragment13 | Ramos | C162(0.82) | LDD2192 | [2] |
| LDCM0576 | Fragment14 | Ramos | C162(0.79); C26(1.01); C370(0.96) | LDD2193 | [2] |
| LDCM0579 | Fragment20 | Ramos | C162(0.71) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C162(0.78) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C162(0.50) | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | C162(0.97) | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | C162(0.71); C26(0.44); C370(0.53) | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | C162(0.82) | LDD2199 | [2] |
| LDCM0589 | Fragment31 | Ramos | C162(0.77) | LDD2200 | [2] |
| LDCM0590 | Fragment32 | Ramos | C162(0.31) | LDD2201 | [2] |
| LDCM0468 | Fragment33 | Ramos | C162(0.60) | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | C162(0.69) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C162(0.78); C26(1.20) | LDD2184 | [2] |
| LDCM0610 | Fragment52 | Ramos | C162(0.98) | LDD2204 | [2] |
| LDCM0614 | Fragment56 | Ramos | C162(0.75) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C162(0.86); C26(0.76) | LDD2186 | [2] |
| LDCM0571 | Fragment9 | Ramos | C162(0.73) | LDD2188 | [2] |
| LDCM0022 | KB02 | Ramos | C162(0.55); C26(0.43) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C162(0.87); C26(0.63); C370(0.75) | LDD2183 | [2] |
| LDCM0024 | KB05 | NALM-6 | C26(1.88) | LDD3339 | [1] |
The Interaction Atlas With This Target
References