Details of the Target

General Information of Target

Target ID LDTP10172
Target Name TRAF-interacting protein with FHA domain-containing protein A (TIFA)
Gene Name TIFA
Gene ID 92610
Synonyms
T2BP; TRAF-interacting protein with FHA domain-containing protein A; Putative MAPK-activating protein PM14; Putative NF-kappa-B-activating protein 20; TRAF2-binding protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
Target Bioclass
Other
Family
TIFA family
Subcellular location
Cytoplasm
Function
Adapter molecule that plays a key role in the activation of pro-inflammatory NF-kappa-B signaling following detection of bacterial pathogen-associated molecular pattern metabolites (PAMPs) . Promotes activation of an innate immune response by inducing the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism. TIFA-dependent innate immune response is triggered by ADP-D-glycero-beta-D-manno-heptose (ADP-Heptose), a potent PAMP present in all Gram-negative and some Gram-positive bacteria: ADP-Heptose is recognized by ALPK1, which phosphorylates TIFA at Thr-9, leading to TIFA homooligomerization and subsequent activation of pro-inflammatory NF-kappa-B signaling.
Uniprot ID
Q96CG3
Ensemble ID
ENST00000361717.4
HGNC ID
HGNC:19075

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0036  [1]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C56(1.58)  LDD2187  [2]
 LDCM0572  Fragment10 Ramos C56(0.70)  LDD2189  [2]
 LDCM0573  Fragment11 Ramos C56(1.61)  LDD2190  [2]
 LDCM0574  Fragment12 Ramos C56(0.68)  LDD2191  [2]
 LDCM0575  Fragment13 Ramos C56(1.18)  LDD2192  [2]
 LDCM0576  Fragment14 Ramos C56(1.18)  LDD2193  [2]
 LDCM0579  Fragment20 Ramos C56(0.59)  LDD2194  [2]
 LDCM0580  Fragment21 Ramos C56(0.89)  LDD2195  [2]
 LDCM0582  Fragment23 Ramos C56(0.79)  LDD2196  [2]
 LDCM0578  Fragment27 Ramos C56(1.13)  LDD2197  [2]
 LDCM0586  Fragment28 Ramos C56(0.69)  LDD2198  [2]
 LDCM0588  Fragment30 Ramos C56(1.11)  LDD2199  [2]
 LDCM0589  Fragment31 Ramos C56(1.17)  LDD2200  [2]
 LDCM0590  Fragment32 Ramos C56(0.95)  LDD2201  [2]
 LDCM0468  Fragment33 Ramos C56(1.04)  LDD2202  [2]
 LDCM0596  Fragment38 Ramos C56(1.34)  LDD2203  [2]
 LDCM0566  Fragment4 Ramos C56(1.05)  LDD2184  [2]
 LDCM0610  Fragment52 Ramos C56(1.18)  LDD2204  [2]
 LDCM0614  Fragment56 Ramos C56(1.31)  LDD2205  [2]
 LDCM0569  Fragment7 Ramos C56(0.83)  LDD2186  [2]
 LDCM0571  Fragment9 Ramos C56(0.85)  LDD2188  [2]
 LDCM0022  KB02 Ramos C56(1.16)  LDD2182  [2]
 LDCM0023  KB03 Ramos C56(1.03)  LDD2183  [2]
 LDCM0024  KB05 Ramos C56(0.67)  LDD2185  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
TNF receptor-associated factor 6 (TRAF6) TNF receptor-associated factor family Q9Y4K3
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-1 complex subunit mu-1 (AP1M1) Adaptor complexes medium subunit family Q9BXS5
Gasdermin-E (GSDME) Gasdermin family O60443
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Syntenin-1 (SDCBP) . O00560
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Segment polarity protein dishevelled homolog DVL-2 (DVL2) DSH family O14641
Protein ripply3 (RIPPLY3) Ripply family P57055
Tumor necrosis factor alpha-induced protein 8 (TNFAIP8) TNFAIP8 family O95379
Large ribosomal subunit protein uL6 (RPL9; RPL9P7; RPL9P8; RPL9P9) Universal ribosomal protein uL6 family P32969
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Rho guanine nucleotide exchange factor 39 (ARHGEF39) . Q8N4T4
Syntenin-2 (SDCBP2) . Q9H190
TRAF-interacting protein with FHA domain-containing protein B (TIFAB) . Q6ZNK6

References

1 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
2 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578