Details of the Target
General Information of Target
| Target ID | LDTP09864 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ras-responsive element-binding protein 1 (RREB1) | |||||
| Gene Name | RREB1 | |||||
| Gene ID | 6239 | |||||
| Synonyms |
FINB; Ras-responsive element-binding protein 1; RREB-1; Finger protein in nuclear bodies; Raf-responsive zinc finger protein LZ321; Zinc finger motif enhancer-binding protein 1; Zep-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK SDSSNSDSTQSQKSGRNSNPRQARN |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus speckle
|
|||||
| Function |
Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1. Promotes brown adipocyte differentiation. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
14.48 | LDD0402 | [1] | |
|
DBIA Probe Info |
![]() |
C309(0.78) | LDD3312 | [2] | |
|
AHL-Pu-1 Probe Info |
![]() |
C856(2.19); C406(2.77) | LDD0171 | [3] | |
|
IA-alkyne Probe Info |
![]() |
C648(0.00); C1242(0.00) | LDD0162 | [4] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [5] | |
|
NAIA_5 Probe Info |
![]() |
C329(0.00); C1629(0.00); C1242(0.00) | LDD2224 | [5] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [6] | |
|
Compound 10 Probe Info |
![]() |
N.A. | LDD2216 | [7] | |
|
Compound 11 Probe Info |
![]() |
N.A. | LDD2213 | [7] | |
|
IPM Probe Info |
![]() |
C329(0.00); C1242(0.00) | LDD0005 | [8] | |
|
Phosphinate-6 Probe Info |
![]() |
C1251(0.00); C329(0.00); C1545(0.00); C1629(0.00) | LDD0018 | [9] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [10] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C856(2.19); C406(2.77) | LDD0171 | [3] |
| LDCM0156 | Aniline | NCI-H1299 | 15.00 | LDD0403 | [1] |
| LDCM0632 | CL-Sc | Hep-G2 | C329(2.32) | LDD2227 | [5] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C1242(1.59); C645(1.38) | LDD1702 | [11] |
| LDCM0022 | KB02 | HEK-293T | C309(0.94); C1242(0.88); C329(0.70); C537(1.20) | LDD1492 | [12] |
| LDCM0023 | KB03 | HEK-293T | C309(1.05); C1242(1.18); C329(1.04); C537(0.93) | LDD1497 | [12] |
| LDCM0024 | KB05 | HMCB | C309(0.78) | LDD3312 | [2] |
References












