Details of the Target

General Information of Target

Target ID LDTP09864
Target Name Ras-responsive element-binding protein 1 (RREB1)
Gene Name RREB1
Gene ID 6239
Synonyms
FINB; Ras-responsive element-binding protein 1; RREB-1; Finger protein in nuclear bodies; Raf-responsive zinc finger protein LZ321; Zinc finger motif enhancer-binding protein 1; Zep-1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK
SDSSNSDSTQSQKSGRNSNPRQARN
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus speckle
Function
Transcription factor that binds specifically to the RAS-responsive elements (RRE) of gene promoters. Represses the angiotensinogen gene. Negatively regulates the transcriptional activity of AR. Potentiates the transcriptional activity of NEUROD1. Promotes brown adipocyte differentiation. May be involved in Ras/Raf-mediated cell differentiation by enhancing calcitonin expression.
Uniprot ID
Q92766
Ensemble ID
ENST00000334984.10
HGNC ID
HGNC:10449

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		14.48  LDD0402  [1]
DBIA
 Probe Info  		C309(0.78)  LDD3312  [2]
AHL-Pu-1
 Probe Info  		C856(2.19); C406(2.77)  LDD0171  [3]
IA-alkyne
 Probe Info  		C648(0.00); C1242(0.00)  LDD0162  [4]
NAIA_4
 Probe Info  		N.A.  LDD2226  [5]
NAIA_5
 Probe Info  		C329(0.00); C1629(0.00); C1242(0.00)  LDD2224  [5]
TFBX
 Probe Info  		N.A.  LDD0027  [6]
Compound 10
 Probe Info  		N.A.  LDD2216  [7]
Compound 11
 Probe Info  		N.A.  LDD2213  [7]
IPM
 Probe Info  		C329(0.00); C1242(0.00)  LDD0005  [8]
Phosphinate-6
 Probe Info  		C1251(0.00); C329(0.00); C1545(0.00); C1629(0.00)  LDD0018  [9]
W1
 Probe Info  		N.A.  LDD0236  [10]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0026  4SU-RNA+native RNA DM93 C856(2.19); C406(2.77)  LDD0171  [3]
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0632  CL-Sc Hep-G2 C329(2.32)  LDD2227  [5]
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C1242(1.59); C645(1.38)  LDD1702  [11]
 LDCM0022  KB02 HEK-293T C309(0.94); C1242(0.88); C329(0.70); C537(1.20)  LDD1492  [12]
 LDCM0023  KB03 HEK-293T C309(1.05); C1242(1.18); C329(1.04); C537(0.93)  LDD1497  [12]
 LDCM0024  KB05 HMCB C309(0.78)  LDD3312  [2]

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
7 Multiplexed CuAAC Suzuki-Miyaura Labeling for Tandem Activity-Based Chemoproteomic Profiling. Anal Chem. 2021 Feb 2;93(4):2610-2618. doi: 10.1021/acs.analchem.0c04726. Epub 2021 Jan 20.
Mass spectrometry data entry: PXD022279
8 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
9 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
10 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
11 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
12 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402