Details of the Target
General Information of Target
| Target ID | LDTP09747 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane O-methyltransferase (TOMT) | |||||
| Gene Name | TOMT | |||||
| Gene ID | 220074 | |||||
| Synonyms |
COMT2; LRTOMT; Transmembrane O-methyltransferase; EC 2.1.1.6; Catechol O-methyltransferase 2; Protein LRTOMT2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAIALAFLPLVVTLLVRYRHYFRLL
VRTVLLRSLRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMGPVKG QILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAG FDEHMVELIVGSSEDVIPCLRTQYQLSRADLVLLAHRPRCYLRDLQLLEAHALLPAGATV LADHVLFPGAPRFLQYAKSCGRYRCRLHHTGLPDFPAIKDGIAQLTYAGPG |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
|
|||||
| Subcellular location |
Cytoplasm; Membrane
|
|||||
| Function |
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function. Component of the cochlear hair cell's mechanotransduction (MET) machinery. Involved in the assembly of the asymmetric tip-link MET complex. Required for transportation of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of the hair cells. The function in MET is independent of the enzymatic activity.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
N.A. | LDD0446 | [1] | |

