Details of the Target
General Information of Target
| Target ID | LDTP09736 | |||||
|---|---|---|---|---|---|---|
| Target Name | Septin-1 (SEPTIN1) | |||||
| Gene Name | SEPTIN1 | |||||
| Gene ID | 1731 | |||||
| Synonyms |
DIFF6; PNUTL3; SEPT1; Septin-1; LARP; Peanut-like protein 3; Serologically defined breast cancer antigen NY-BR-24 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGGVMDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQ
VPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFE QYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADAL MPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVR DGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQ SLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQ QSQAQGEQSDAL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). {, }. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K349(20.00) | LDD2219 | [1] | |
|
DBIA Probe Info |
![]() |
C260(11.60) | LDD0209 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C236(0.00); C298(0.00) | LDD0166 | [3] | |
|
IPIAA_H Probe Info |
![]() |
N.A. | LDD0030 | [4] | |
|
IPIAA_L Probe Info |
![]() |
N.A. | LDD0031 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-2 Probe Info |
![]() |
N.A. | LDD0139 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C298(0.99) | LDD2187 | [6] |
| LDCM0572 | Fragment10 | Ramos | C298(1.03) | LDD2189 | [6] |
| LDCM0573 | Fragment11 | Ramos | C298(0.12); C265(2.15) | LDD2190 | [6] |
| LDCM0574 | Fragment12 | Ramos | C298(1.68) | LDD2191 | [6] |
| LDCM0575 | Fragment13 | Ramos | C298(1.24) | LDD2192 | [6] |
| LDCM0576 | Fragment14 | Ramos | C298(0.95); C265(0.62) | LDD2193 | [6] |
| LDCM0579 | Fragment20 | Ramos | C298(1.73) | LDD2194 | [6] |
| LDCM0580 | Fragment21 | Ramos | C298(1.12) | LDD2195 | [6] |
| LDCM0582 | Fragment23 | Ramos | C298(1.37) | LDD2196 | [6] |
| LDCM0578 | Fragment27 | Ramos | C298(1.04) | LDD2197 | [6] |
| LDCM0586 | Fragment28 | Ramos | C298(0.79); C265(7.43) | LDD2198 | [6] |
| LDCM0588 | Fragment30 | Ramos | C298(1.74) | LDD2199 | [6] |
| LDCM0589 | Fragment31 | Ramos | C298(1.19) | LDD2200 | [6] |
| LDCM0590 | Fragment32 | Ramos | C298(1.06) | LDD2201 | [6] |
| LDCM0468 | Fragment33 | Ramos | C298(1.71) | LDD2202 | [6] |
| LDCM0596 | Fragment38 | Ramos | C298(1.28) | LDD2203 | [6] |
| LDCM0566 | Fragment4 | Ramos | C298(0.83); C265(2.37) | LDD2184 | [6] |
| LDCM0610 | Fragment52 | Ramos | C298(1.64) | LDD2204 | [6] |
| LDCM0614 | Fragment56 | Ramos | C298(1.56) | LDD2205 | [6] |
| LDCM0569 | Fragment7 | Ramos | C298(0.52); C265(0.84) | LDD2186 | [6] |
| LDCM0571 | Fragment9 | Ramos | C298(1.08) | LDD2188 | [6] |
| LDCM0022 | KB02 | T cell | C99, C102(5.33); C260(12.92) | LDD1707 | [7] |
| LDCM0023 | KB03 | Jurkat | C260(11.60) | LDD0209 | [2] |
| LDCM0024 | KB05 | NALM-6 | C231(1.27) | LDD3339 | [8] |
| LDCM0131 | RA190 | MM1.R | C293(1.36) | LDD0304 | [9] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Syntenin-1 (SDCBP) | . | O00560 | |||
Other
References






