Details of the Target
General Information of Target
| Target ID | LDTP09633 | |||||
|---|---|---|---|---|---|---|
| Target Name | PEST proteolytic signal-containing nuclear protein (PCNP) | |||||
| Gene Name | PCNP | |||||
| Gene ID | 57092 | |||||
| Synonyms |
PEST proteolytic signal-containing nuclear protein; PCNP; PEST-containing nuclear protein |
|||||
| 3D Structure | ||||||
| Sequence |
MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAAD
LPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSE PEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in cell cycle regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
10.00 | LDD0393 | [1] | |
|
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [2] | |
|
ATP probe Probe Info |
![]() |
K167(0.00); K150(0.00); K152(0.00); K160(0.00) | LDD0199 | [3] | |
|
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [2] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [4] | |
|
NHS Probe Info |
![]() |
K152(0.00); K67(0.00); K150(0.00); K70(0.00) | LDD0010 | [5] | |
|
STPyne Probe Info |
![]() |
K150(0.00); K67(0.00) | LDD0009 | [5] | |
|
1c-yne Probe Info |
![]() |
N.A. | LDD0228 | [6] | |
|
Acrolein Probe Info |
![]() |
H169(0.00); H174(0.00) | LDD0217 | [7] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References









