Details of the Target
General Information of Target
| Target ID | LDTP09612 | |||||
|---|---|---|---|---|---|---|
| Target Name | Spindle and kinetochore-associated protein 2 (SKA2) | |||||
| Gene Name | SKA2 | |||||
| Gene ID | 348235 | |||||
| Synonyms |
FAM33A; Spindle and kinetochore-associated protein 2; Protein FAM33A |
|||||
| 3D Structure | ||||||
| Sequence |
MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTL
YARFKPVAVEQKESKSRICATVKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPD L |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SKA2 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, spindle
|
|||||
| Function |
Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it is required for SKA1 localization. Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Probe 1 Probe Info |
 |
Y21(5.87); Y24(14.11) | LDD3495 | [1] | |
|
DBIA Probe Info |
 |
C79(3.32) | LDD3310 | [2] | |
|
BTD Probe Info |
 |
C79(0.65) | LDD2133 | [3] | |
|
IPM Probe Info |
 |
C79(2.53) | LDD1701 | [3] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0165 | [4] | |
|
AOyne Probe Info |
 |
15.00 | LDD0443 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0573 | Fragment11 | Ramos | C79(12.82) | LDD2190 | [6] |
| LDCM0576 | Fragment14 | Ramos | C79(1.74) | LDD2193 | [6] |
| LDCM0586 | Fragment28 | Ramos | C79(1.65) | LDD2198 | [6] |
| LDCM0022 | KB02 | A673 | C79(2.72) | LDD2261 | [2] |
| LDCM0023 | KB03 | MDA-MB-231 | C79(2.53) | LDD1701 | [3] |
| LDCM0024 | KB05 | COLO792 | C79(3.32) | LDD3310 | [2] |
| LDCM0540 | Nucleophilic fragment 35 | MDA-MB-231 | C79(0.65) | LDD2133 | [3] |
The Interaction Atlas With This Target
References