Details of the Target

General Information of Target

Target ID LDTP09599
Target Name MIT domain-containing protein 1 (MITD1)
Gene Name MITD1
Gene ID 129531
Synonyms
MIT domain-containing protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCN
LREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI
EDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSH
GVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDI
FHKKHTKNI
Target Bioclass
Other
Subcellular location
Late endosome membrane
Function Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT-III complex.
Uniprot ID
Q8WV92
Ensemble ID
ENST00000289359.6
HGNC ID
HGNC:25207

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info  		C59(0.66)  LDD2131  [1]
DBIA
 Probe Info  		C138(65.62)  LDD0209  [2]
IA-alkyne
 Probe Info  		C37(0.00); C226(0.00)  LDD0165  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0538  4-(Cyanoacetyl)morpholine MDA-MB-231 C59(0.66)  LDD2131  [1]
 LDCM0625  F8 Ramos C138(0.75)  LDD2187  [4]
 LDCM0572  Fragment10 Ramos C138(0.71)  LDD2189  [4]
 LDCM0573  Fragment11 Ramos C138(0.84)  LDD2190  [4]
 LDCM0574  Fragment12 Ramos C138(0.69)  LDD2191  [4]
 LDCM0576  Fragment14 Ramos C138(0.70)  LDD2193  [4]
 LDCM0579  Fragment20 Ramos C138(0.47)  LDD2194  [4]
 LDCM0580  Fragment21 Ramos C138(0.95)  LDD2195  [4]
 LDCM0588  Fragment30 Ramos C138(1.17)  LDD2199  [4]
 LDCM0590  Fragment32 Ramos C138(0.48)  LDD2201  [4]
 LDCM0468  Fragment33 Ramos C138(0.82)  LDD2202  [4]
 LDCM0596  Fragment38 Ramos C138(1.25)  LDD2203  [4]
 LDCM0566  Fragment4 Ramos C138(0.90)  LDD2184  [4]
 LDCM0569  Fragment7 Ramos C138(0.73)  LDD2186  [4]
 LDCM0571  Fragment9 Ramos C138(0.60)  LDD2188  [4]
 LDCM0022  KB02 HEK-293T C226(1.06); C233(1.06)  LDD1492  [5]
 LDCM0023  KB03 Jurkat C138(65.62)  LDD0209  [2]
 LDCM0024  KB05 HEK-293T C226(0.95); C233(0.95)  LDD1502  [5]
 LDCM0544  Nucleophilic fragment 39 MDA-MB-231 C59(0.97)  LDD2137  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 655 (ZNF655) Krueppel C2H2-type zinc-finger protein family Q8N720
Other
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Charged multivesicular body protein 1a (CHMP1A) SNF7 family Q9HD42
Charged multivesicular body protein 1b (CHMP1B) SNF7 family Q7LBR1
Charged multivesicular body protein 2a (CHMP2A) SNF7 family O43633
Charged multivesicular body protein 5 (CHMP5) SNF7 family Q9NZZ3
Abscission/NoCut checkpoint regulator (ZFYVE19) . Q96K21
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
MIT domain-containing protein 1 (MITD1) . Q8WV92
Tetratricopeptide repeat protein 33 (TTC33) . Q6PID6

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 Covalent Inhibition by a Natural Product-Inspired Latent Electrophile. J Am Chem Soc. 2023 May 24;145(20):11097-11109. doi: 10.1021/jacs.3c00598. Epub 2023 May 15.
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402