Details of the Target
General Information of Target
| Target ID | LDTP09595 | |||||
|---|---|---|---|---|---|---|
| Target Name | B-cell linker protein (BLNK) |
|
||||
| Gene Name | BLNK | |||||
| Gene ID | 29760 | |||||
| Synonyms |
BASH; SLP65; B-cell linker protein; B-cell adapter containing a SH2 domain protein; B-cell adapter containing a Src homology 2 domain protein; Cytoplasmic adapter protein; Src homology 2 domain-containing leukocyte protein of 65 kDa; SLP-65
|
|||||
| 3D Structure | ||||||
| Sequence |
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADE
EEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYI DNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVV PVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPA APSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQ KQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEAL HRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFG SVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Functions as a central linker protein, downstream of the B-cell receptor (BCR), bridging the SYK kinase to a multitude of signaling pathways and regulating biological outcomes of B-cell function and development. Plays a role in the activation of ERK/EPHB2, MAP kinase p38 and JNK. Modulates AP1 activation. Important for the activation of NF-kappa-B and NFAT. Plays an important role in BCR-mediated PLCG1 and PLCG2 activation and Ca(2+) mobilization and is required for trafficking of the BCR to late endosomes. However, does not seem to be required for pre-BCR-mediated activation of MAP kinase and phosphatidyl-inositol 3 (PI3) kinase signaling. May be required for the RAC1-JNK pathway. Plays a critical role in orchestrating the pro-B cell to pre-B cell transition. May play an important role in BCR-induced B-cell apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C271(1.08) | LDD3339 | [1] | |
|
IA-alkyne Probe Info |
 |
C271(0.42) | LDD2182 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C271(0.62) | LDD2187 | [2] |
| LDCM0572 | Fragment10 | Ramos | C271(1.40) | LDD2189 | [2] |
| LDCM0573 | Fragment11 | Ramos | C271(0.44) | LDD2190 | [2] |
| LDCM0574 | Fragment12 | Ramos | C271(0.61) | LDD2191 | [2] |
| LDCM0575 | Fragment13 | Ramos | C271(1.29) | LDD2192 | [2] |
| LDCM0576 | Fragment14 | Ramos | C271(0.63) | LDD2193 | [2] |
| LDCM0579 | Fragment20 | Ramos | C271(0.47) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C271(1.73) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C271(1.96) | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | C271(1.56) | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | C271(0.62) | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | C271(2.36) | LDD2199 | [2] |
| LDCM0589 | Fragment31 | Ramos | C271(1.55) | LDD2200 | [2] |
| LDCM0590 | Fragment32 | Ramos | C271(1.04) | LDD2201 | [2] |
| LDCM0468 | Fragment33 | Ramos | C271(1.75) | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | C271(1.14) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C271(0.66) | LDD2184 | [2] |
| LDCM0610 | Fragment52 | Ramos | C271(0.96) | LDD2204 | [2] |
| LDCM0614 | Fragment56 | Ramos | C271(1.43) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C271(0.40) | LDD2186 | [2] |
| LDCM0571 | Fragment9 | Ramos | C271(0.73) | LDD2188 | [2] |
| LDCM0022 | KB02 | Ramos | C271(0.42) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C271(0.65) | LDD2183 | [2] |
| LDCM0024 | KB05 | NALM-6 | C271(1.08) | LDD3339 | [1] |
References