General Information of Target

Target ID LDTP09567
Target Name Tsukushi (TSKU)
Gene Name TSKU
Gene ID 25987
Synonyms
E2IG4; LRRC54; TSK; Tsukushi; E2-induced gene 4 protein; Leucine-rich repeat-containing protein 54
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MPWPLLLLLAVSGAQTTRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDT
AHLDLSSNRLEMVNESVLAGPGYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGL
TALPAESFTSSPLSDVNLSHNQLREVSVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAG
LPAPTIQSLNLAWNRLHAVPNLRDLPLRYLSLDGNPLAVIGPGAFAGLGGLTHLSLASLQ
RLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFSGLSSLQELDLSGTNLVPLPEALLL
HLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVDTRDSAARGPTIL
Target Bioclass
Other
Subcellular location
Secreted
Function
Contributes to various developmental events and other processes such as wound healing and cholesterol homeostasis through its interactions with multiple signaling pathways. Wnt signaling inhibitor which competes with WNT2B for binding to Wnt receptor FZD4 and represses WNT2B-dependent development of the peripheral eye. Plays a role in regulating the hair cycle by controlling TGFB1 signaling. Required for the development of the anterior commissure in the brain by inhibiting neurite outgrowth. Essential for terminal differentiation of hippocampal neural stem cells. Plays a role in regulating bone elongation and bone mass by modulating growth plate chondrocyte function and overall body size. Required for development of the inner ear through its involvement in stereocilia formation in inner hair cells. Facilitates wound healing by inhibiting secretion of TGFB1 from macrophages which prevents myofibroblast differentiation, maintaining inflammatory cell quiescence. Plays a role in cholesterol homeostasis by reducing circulating high-density lipoprotein cholesterol, lowering cholesterol efflux capacity and decreasing cholesterol-to-bile acid conversion in the liver. In one study, shown to negatively regulate sympathetic innervation in brown fat, leading to reduced energy expenditure. In another study, shown not to affect brown fat thermogenic capacity, body weight gain or glucose homeostasis.
Uniprot ID
Q8WUA8
Ensemble ID
ENST00000333090.5
HGNC ID
HGNC:28850

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C339(2.44)  LDD3348  [1]
IA-alkyne
 Probe Info 
N.A.  LDD0162  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0270  AC15 HEK-293T C339(1.18)  LDD1513  [3]
 LDCM0283  AC23 HEK-293T C339(0.96)  LDD1522  [3]
 LDCM0292  AC31 HEK-293T C339(1.00)  LDD1531  [3]
 LDCM0300  AC39 HEK-293T C339(1.05)  LDD1539  [3]
 LDCM0309  AC47 HEK-293T C339(1.04)  LDD1548  [3]
 LDCM0318  AC55 HEK-293T C339(1.07)  LDD1557  [3]
 LDCM0327  AC63 HEK-293T C339(0.99)  LDD1566  [3]
 LDCM0334  AC7 HEK-293T C339(1.06)  LDD1568  [3]
 LDCM0379  CL11 HEK-293T C339(1.14)  LDD1583  [3]
 LDCM0411  CL23 HEK-293T C339(1.07)  LDD1615  [3]
 LDCM0424  CL35 HEK-293T C339(1.21)  LDD1628  [3]
 LDCM0437  CL47 HEK-293T C339(1.12)  LDD1641  [3]
 LDCM0450  CL59 HEK-293T C339(1.21)  LDD1653  [3]
 LDCM0464  CL71 HEK-293T C339(1.10)  LDD1667  [3]
 LDCM0477  CL83 HEK-293T C339(1.06)  LDD1680  [3]
 LDCM0490  CL95 HEK-293T C339(1.20)  LDD1693  [3]
 LDCM0022  KB02 A2058 C339(2.25)  LDD2253  [1]
 LDCM0023  KB03 A2058 C339(3.27)  LDD2670  [1]
 LDCM0024  KB05 NCI-H1792 C339(2.44)  LDD3348  [1]

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402