Details of the Target
General Information of Target
| Target ID | LDTP09449 | |||||
|---|---|---|---|---|---|---|
| Target Name | Glucosamine-6-phosphate isomerase 2 (GNPDA2) | |||||
| Gene Name | GNPDA2 | |||||
| Gene ID | 132789 | |||||
| Synonyms |
GNP2; Glucosamine-6-phosphate isomerase 2; EC 3.5.99.6; Glucosamine-6-phosphate deaminase 2; GNPDA 2; GlcN6P deaminase 2; Glucosamine-6-phosphate isomerase SB52 |
|||||
| 3D Structure | ||||||
| Sequence |
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGH
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA FENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD EDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glucosamine/galactosamine-6-phosphate isomerase family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Catalyzes the reversible conversion of alpha-D-glucosamine 6-phosphate (GlcN-6P) into beta-D-fructose 6-phosphate (Fru-6P) and ammonium ion, a regulatory reaction step in de novo uridine diphosphate-N-acetyl-alpha-D-glucosamine (UDP-GlcNAc) biosynthesis via hexosamine pathway. Deamination is coupled to aldo-keto isomerization mediating the metabolic flux from UDP-GlcNAc toward Fru-6P. At high ammonium level can drive amination and isomerization of Fru-6P toward hexosamines and UDP-GlcNAc synthesis. Has a role in fine tuning the metabolic fluctuations of cytosolic UDP-GlcNAc and their effects on hyaluronan synthesis that occur during tissue remodeling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CAL148 | SNV: p.A185S | DBIA Probe Info | |||
| HT115 | SNV: p.F93I; p.A211D | . | |||
| L428 | SNV: p.R79I | . | |||
| LUDLU1 | SNV: p.K264E | DBIA Probe Info | |||
| SNU245 | Deletion: p.K126RfsTer22 | DBIA Probe Info | |||
| WM2664 | SNV: p.D119N | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C48(1.37) | LDD3312 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C48(2.01) | LDD0171 | [2] | |
|
HHS-475 Probe Info |
 |
Y34(0.81) | LDD0264 | [3] | |
|
HHS-465 Probe Info |
 |
Y34(10.00) | LDD2237 | [4] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0036 | [5] | |
|
Lodoacetamide azide Probe Info |
 |
N.A. | LDD0037 | [5] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0217 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C48(2.01) | LDD0171 | [2] |
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [6] |
| LDCM0116 | HHS-0101 | DM93 | Y34(0.81) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y34(0.74) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y34(0.84) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y34(0.85) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y34(0.85) | LDD0268 | [3] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [6] |
| LDCM0022 | KB02 | 42-MG-BA | C48(0.95) | LDD2244 | [1] |
| LDCM0023 | KB03 | 42-MG-BA | C48(1.11) | LDD2661 | [1] |
| LDCM0024 | KB05 | HMCB | C48(1.37) | LDD3312 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0224 | [6] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein mago nashi homolog 2 (MAGOHB) | Mago nashi family | Q96A72 | |||
References