Details of the Target

General Information of Target

Target ID LDTP09340
Target Name Bromo adjacent homology domain-containing 1 protein (BAHD1)
Gene Name BAHD1
Gene ID 22893
Synonyms
KIAA0945; Bromo adjacent homology domain-containing 1 protein; BAH domain-containing protein 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MTHTRRKSLPMLSSGLTGRREPLQMEDSNMEQGVEGVEPGMPESPGHLTGRRKNYPLRKR
PLVPEKPKACKVLLTRLENVAGPRSADEADELPPDLPKPPSPAPSSEDPGLAQPRKRRLA
SLNAEALNNLLLEREDTSSLAGTRRSRAGDPHRSRDRDRATGGWSSSKKRPRLGDLGGGS
RDLSPEPAPDEGPRRDGDPAPKRLASLNAAAFLKLSQERELPLRLPRAHAEVDGRSTEPP
APKAPRPKWPKVNGKNYPKAWQGASSGEAAGPPGWQGCPDEPWPSATPCGPSVQPSHQPL
SKALESPLGLRPHLPLLMGGQAALKPEPGRPGEESPAPKQELHQPSFPTPQLSPLPMPGN
PADYNGLCVGPELTALGSFYLYCGQEGLQCGGYSPCPMLPEGKLSPVAAPHEEGLLLAPS
SVPSGTPFQHPPWGSSRYCSSEDTGVNGYSICGVLPLSVTHAGTTCGGCPYKMPFAAEGC
RSLGQLEFPLPEAGHPASPAHPLLGCPVPSVPPAAEPVPHLQTPTSEPQTVARACPQSAK
PPSGSKSGLRTGSSCRHTARSKAARRPSHPKQPRVQRPRPRRRRRRRTNGWVPVGAACEK
AVYVLDEPEPAIRKSYQAVERHGETIRVRDTVLLKSGPRKTSTPYVAKISALWENPESGE
LMMSLLWYYRPEHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFC
AMAKRRGEGLPSRKTALVPPSADYSTPPHRTVPEDTDPELVFLCRHVYDFRHGRILKNPQ
Target Bioclass
Other
Subcellular location
Nucleus
Function
Heterochromatin protein that acts as a transcription repressor and has the ability to promote the formation of large heterochromatic domains. May act by recruiting heterochromatin proteins such as CBX5 (HP1 alpha), HDAC5 and MBD1. Represses IGF2 expression by binding to its CpG-rich P3 promoter and recruiting heterochromatin proteins. At specific stages of Listeria infection, in complex with TRIM28, corepresses interferon-stimulated genes, including IFNL1, IFNL2 and IFNL3.
Uniprot ID
Q8TBE0
Ensemble ID
ENST00000416165.6
HGNC ID
HGNC:29153

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 SNV: p.R639Q .
IM95 SNV: p.M41V .
JURKAT SNV: p.G425S .
MCC13 SNV: p.T374I .
MEWO SNV: p.S553F DBIA    Probe Info 
PF382 SNV: p.L316P DBIA    Probe Info 
SW837 SNV: p.R118C .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C535(1.99)  LDD3312  [1]
IA-alkyne
 Probe Info  		C703(0.00); C720(0.00); C535(0.00)  LDD0165  [2]
IPM
 Probe Info  		C535(0.00); C555(0.00)  LDD0147  [3]
TFBX
 Probe Info  		C555(0.00); C535(0.00)  LDD0148  [3]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C703(1.36)  LDD1507  [5]
 LDCM0259  AC14 HEK-293T C535(1.12)  LDD1512  [5]
 LDCM0276  AC17 HEK-293T C703(1.26)  LDD1515  [5]
 LDCM0282  AC22 HEK-293T C535(1.02)  LDD1521  [5]
 LDCM0285  AC25 HEK-293T C703(1.26)  LDD1524  [5]
 LDCM0291  AC30 HEK-293T C535(1.01)  LDD1530  [5]
 LDCM0294  AC33 HEK-293T C703(1.43)  LDD1533  [5]
 LDCM0299  AC38 HEK-293T C535(1.01)  LDD1538  [5]
 LDCM0303  AC41 HEK-293T C703(1.32)  LDD1542  [5]
 LDCM0308  AC46 HEK-293T C535(1.08)  LDD1547  [5]
 LDCM0311  AC49 HEK-293T C703(1.15)  LDD1550  [5]
 LDCM0317  AC54 HEK-293T C535(1.06)  LDD1556  [5]
 LDCM0320  AC57 HEK-293T C703(1.35)  LDD1559  [5]
 LDCM0323  AC6 HEK-293T C535(1.05)  LDD1562  [5]
 LDCM0326  AC62 HEK-293T C535(0.99)  LDD1565  [5]
 LDCM0356  AKOS034007680 HEK-293T C703(1.38)  LDD1570  [5]
 LDCM0368  CL10 HEK-293T C535(1.12)  LDD1572  [5]
 LDCM0404  CL17 HEK-293T C703(1.53)  LDD1608  [5]
 LDCM0410  CL22 HEK-293T C535(1.07)  LDD1614  [5]
 LDCM0417  CL29 HEK-293T C703(1.11)  LDD1621  [5]
 LDCM0423  CL34 HEK-293T C535(0.95)  LDD1627  [5]
 LDCM0431  CL41 HEK-293T C703(1.63)  LDD1635  [5]
 LDCM0436  CL46 HEK-293T C535(1.01)  LDD1640  [5]
 LDCM0440  CL5 HEK-293T C703(1.30)  LDD1644  [5]
 LDCM0444  CL53 HEK-293T C703(1.27)  LDD1647  [5]
 LDCM0449  CL58 HEK-293T C535(1.12)  LDD1652  [5]
 LDCM0457  CL65 HEK-293T C703(1.21)  LDD1660  [5]
 LDCM0463  CL70 HEK-293T C535(1.08)  LDD1666  [5]
 LDCM0470  CL77 HEK-293T C703(1.37)  LDD1673  [5]
 LDCM0476  CL82 HEK-293T C535(1.08)  LDD1679  [5]
 LDCM0483  CL89 HEK-293T C703(1.20)  LDD1686  [5]
 LDCM0489  CL94 HEK-293T C535(1.05)  LDD1692  [5]
 LDCM0022  KB02 HEK-293T C535(0.95)  LDD1492  [5]
 LDCM0023  KB03 HEK-293T C535(1.02)  LDD1497  [5]
 LDCM0024  KB05 HMCB C535(1.99)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
PR domain zinc finger protein 14 (PRDM14) Class V-like SAM-binding methyltransferase superfamily Q9GZV8
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
TGF-beta receptor type-2 (TGFBR2) TKL Ser/Thr protein kinase family P37173
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
Transcription initiation factor IIB (GTF2B) TFIIB family Q00403
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
Eukaryotic translation initiation factor 2 subunit 3 (EIF2S3) Classic translation factor GTPase family P41091
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Importin subunit alpha-4 (KPNA3) Importin alpha family O00505
MyoD family inhibitor (MDFI) MDFI family Q99750
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Alpha-crystallin A chain (CRYAA) Small heat shock protein (HSP20) family P02489
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription regulator protein BACH2 (BACH2) BZIP family Q9BYV9
Zinc finger protein 275 (ZNF275) Krueppel C2H2-type zinc-finger protein family Q9NSD4
Zinc finger protein 317 (ZNF317) Krueppel C2H2-type zinc-finger protein family Q96PQ6
Zinc finger protein 526 (ZNF526) Krueppel C2H2-type zinc-finger protein family Q8TF50
Zinc finger protein 837 (ZNF837) Krueppel C2H2-type zinc-finger protein family Q96EG3
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Zinc finger protein 408 (ZNF408) . Q9H9D4
Other
Click To Hide/Show 32 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) CALCOCO family Q13137
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Heat shock-related 70 kDa protein 2 (HSPA2) Heat shock protein 70 family P54652
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Prelamin-A/C (LMNA) Intermediate filament family P02545
KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2) KHDRBS family Q5VWX1
KH domain-containing, RNA-binding, signal transduction-associated protein 3 (KHDRBS3) KHDRBS family O75525
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 2-4 (KRTAP2-4) KRTAP type 2 family Q9BYR9
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Protein Dr1 (DR1) NC2 beta/DR1 family Q01658
Serpin H1 (SERPINH1) Serpin family P50454
Gelsolin (GSN) Villin/gelsolin family P06396
TLE family member 5 (TLE5) WD repeat Groucho/TLE family Q08117
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Chromobox protein homolog 1 (CBX1) . P83916
Chromobox protein homolog 5 (CBX5) . P45973
General transcription factor 3C polypeptide 3 (GTF3C3) . Q9Y5Q9
Meiosis 1 arrest protein (M1AP) . Q8TC57
PRKCA-binding protein (PICK1) . Q9NRD5
RNA-binding protein 10 (RBM10) . P98175
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TAR DNA-binding protein 43 (TARDBP) . Q13148
Ubiquilin-1 (UBQLN1) . Q9UMX0

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
4 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004
5 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402