Details of the Target
General Information of Target
| Target ID | LDTP09307 | |||||
|---|---|---|---|---|---|---|
| Target Name | LIM domain only protein 3 (LMO3) | |||||
| Gene Name | LMO3 | |||||
| Gene ID | 55885 | |||||
| Synonyms |
RBTN3; RBTNL2; RHOM3; LIM domain only protein 3; LMO-3; Neuronal-specific transcription factor DAT1; Rhombotin-3 |
|||||
| 3D Structure | ||||||
| Sequence |
MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANL
ILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFL KNNMILCQTDYEEGLMKEGYAPQVR |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C81(1.01) | LDD3358 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C113(0.76) | LDD2182 | [2] | |
|
N1 Probe Info |
![]() |
M89(0.00); M91(0.00) | LDD0245 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C113(1.22) | LDD2187 | [2] |
| LDCM0572 | Fragment10 | Ramos | C113(0.58) | LDD2189 | [2] |
| LDCM0574 | Fragment12 | Ramos | C113(0.50) | LDD2191 | [2] |
| LDCM0576 | Fragment14 | Ramos | C113(0.53) | LDD2193 | [2] |
| LDCM0579 | Fragment20 | Ramos | C113(0.53) | LDD2194 | [2] |
| LDCM0580 | Fragment21 | Ramos | C113(0.68) | LDD2195 | [2] |
| LDCM0582 | Fragment23 | Ramos | C113(0.73) | LDD2196 | [2] |
| LDCM0578 | Fragment27 | Ramos | C113(1.18) | LDD2197 | [2] |
| LDCM0586 | Fragment28 | Ramos | C113(0.81) | LDD2198 | [2] |
| LDCM0588 | Fragment30 | Ramos | C113(0.68) | LDD2199 | [2] |
| LDCM0589 | Fragment31 | Ramos | C113(0.78) | LDD2200 | [2] |
| LDCM0590 | Fragment32 | Ramos | C113(0.56) | LDD2201 | [2] |
| LDCM0468 | Fragment33 | Ramos | C113(0.40) | LDD2202 | [2] |
| LDCM0596 | Fragment38 | Ramos | C113(0.64) | LDD2203 | [2] |
| LDCM0566 | Fragment4 | Ramos | C113(0.70) | LDD2184 | [2] |
| LDCM0610 | Fragment52 | Ramos | C113(0.60) | LDD2204 | [2] |
| LDCM0614 | Fragment56 | Ramos | C113(0.69) | LDD2205 | [2] |
| LDCM0569 | Fragment7 | Ramos | C113(0.90) | LDD2186 | [2] |
| LDCM0571 | Fragment9 | Ramos | C113(0.34) | LDD2188 | [2] |
| LDCM0022 | KB02 | Ramos | C113(0.76) | LDD2182 | [2] |
| LDCM0023 | KB03 | Ramos | C113(0.81) | LDD2183 | [2] |
| LDCM0024 | KB05 | NCI-H2291 | C81(1.01) | LDD3358 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| D(1A) dopamine receptor (DRD1) | G-protein coupled receptor 1 family | P21728 | |||
| Probable G-protein coupled receptor 160 (GPR160) | G-protein coupled receptor 1 family | Q9UJ42 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amphoterin-induced protein 1 (AMIGO1) | AMIGO family | Q86WK6 | |||
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Interleukin-3 receptor subunit alpha (IL3RA) | Type I cytokine receptor family | P26951 | |||
Other
References



