Details of the Target

General Information of Target

Target ID LDTP09257
Target Name Centrosomal protein of 70 kDa (CEP70)
Gene Name CEP70
Gene ID 80321
Synonyms
BITE; Centrosomal protein of 70 kDa; Cep70; p10-binding protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MFPVAPKPQDSSQPSDRLMTEKQQEEAEWESINVLLMMHGLKPLSLVKRTDLKDLIIFDK
QSSQRMRQNLKLLVEETSCQQNMIQELIETNQQLRNELQLEQSRAANQEQRANDLEQIME
SVKSKIGELEDESLSRACHQQNKIKDLQKEQKTLQVKCQHYKKKRTEQEETIASLQMEVC
RLKKEEEDRIVTQNRVFAYLCKRVPHTVLDRQLLCLIDYYESKIRKIHTQRQYKEDESQS
EEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALSSEKLNLQKDLETRPTQHELRLYK
QQVKKLEKALKKNVKLQELINHKKAEDTEKKDEPSKYNQQQALIDQRYFQVLCSINSIIH
NPRAPVIIYKQTKGGVQNFNKDLVQDCGFEHLVPVIEMWADQLTSLKDLYKSLKTLSAEL
VPWLNLKKQDENEGIKVEDLLFIVDTMLEEVENKEKDSNMPHFQTLQAIVSHFQKLFDVP
SLNGVYPRMNEVYTRLGEMNNAVRNLQELLELDSSSSLCVLVSTVGKLCRLINEDVNEQV
MQVLGPEDLQSIIYKLEEHEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKVLSY
Target Bioclass
Other
Subcellular location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Function Plays a role in the organization of both preexisting and nascent microtubules in interphase cells. During mitosis, required for the organization and orientation of the mitotic spindle.
Uniprot ID
Q8NHQ1
Ensemble ID
ENST00000264982.8
HGNC ID
HGNC:29972

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.L258F .
NCIH1048 SNV: p.Y220C .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C138(1.00)  LDD1512  [1]
CY-1
 Probe Info  		Q339(0.00); Q340(0.00); Q341(0.00)  LDD0246  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C138(1.00)  LDD1512  [1]
 LDCM0282  AC22 HEK-293T C138(0.85)  LDD1521  [1]
 LDCM0291  AC30 HEK-293T C138(1.07)  LDD1530  [1]
 LDCM0299  AC38 HEK-293T C138(1.06)  LDD1538  [1]
 LDCM0308  AC46 HEK-293T C138(1.06)  LDD1547  [1]
 LDCM0317  AC54 HEK-293T C138(1.27)  LDD1556  [1]
 LDCM0323  AC6 HEK-293T C138(1.18)  LDD1562  [1]
 LDCM0326  AC62 HEK-293T C138(1.19)  LDD1565  [1]
 LDCM0368  CL10 HEK-293T C138(0.97)  LDD1572  [1]
 LDCM0410  CL22 HEK-293T C138(1.17)  LDD1614  [1]
 LDCM0423  CL34 HEK-293T C138(1.05)  LDD1627  [1]
 LDCM0436  CL46 HEK-293T C138(1.49)  LDD1640  [1]
 LDCM0449  CL58 HEK-293T C138(1.47)  LDD1652  [1]
 LDCM0463  CL70 HEK-293T C138(1.13)  LDD1666  [1]
 LDCM0476  CL82 HEK-293T C138(1.29)  LDD1679  [1]
 LDCM0489  CL94 HEK-293T C138(1.15)  LDD1692  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 34 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
60 kDa heat shock protein, mitochondrial (HSPD1) Chaperonin (HSP60) family P10809
Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase (NOP2) RsmB/NOP family P46087
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1) Histone-lysine methyltransferase family O43463
Tyrosine--tRNA ligase, cytoplasmic (YARS1) Class-I aminoacyl-tRNA synthetase family P54577
Mitochondrial disaggregase (CLPB) ClpA/ClpB family Q9H078
Probable ATP-dependent RNA helicase DDX41 (DDX41) DEAD box helicase family Q9UJV9
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Lysine-specific histone demethylase 1A (KDM1A) Flavin monoamine oxidase family O60341
Glutathione peroxidase 7 (GPX7) Glutathione peroxidase family Q96SL4
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
General transcription and DNA repair factor IIH helicase subunit XPB (ERCC3) Helicase family P19447
Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A (INPP5J) Inositol 1,4,5-trisphosphate 5-phosphatase type II family Q15735
Inositol-trisphosphate 3-kinase B (ITPKB) Inositol phosphokinase (IPK) family P27987
Superoxide dismutase [Mn], mitochondrial (SOD2) Iron/manganese superoxide dismutase family P04179
Protein mab-21-like 2 (MAB21L2) Mab-21 family Q9Y586
Methyltransferase-like protein 17, mitochondrial (METTL17) Rsm22 family Q9H7H0
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Serine/threonine-protein kinase tousled-like 2 (TLK2) Ser/Thr protein kinase family Q86UE8
Serine/threonine-protein kinase 25 (STK25) STE Ser/Thr protein kinase family O00506
E3 ubiquitin-protein ligase RNF169 (RNF169) RNF169 family Q8NCN4
GTP-binding protein GEM (GEM) RGK family P55040
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
Tripartite motif-containing protein 3 (TRIM3) TRIM/RBCC family O75382
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
BRCA1-associated RING domain protein 1 (BARD1) . Q99728
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Peptidyl-prolyl cis-trans isomerase G (PPIG) . Q13427
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
TATA box-binding protein-associated factor RNA polymerase I subunit D (TAF1D) . Q9H5J8
Tripartite motif-containing protein 29 (TRIM29) . Q14134
Transporter and channel
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ATP synthase subunit O, mitochondrial (ATP5PO) ATPase delta chain family P48047
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
mRNA export factor GLE1 (GLE1) GLE1 family Q53GS7
Huntingtin (HTT) Huntingtin family P42858
Protein mago nashi homolog (MAGOH) Mago nashi family P61326
SEC14-like protein 1 (SEC14L1) . Q92503
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Synaptotagmin-like protein 4 (SYTL4) . Q96C24
Transcription factor
Click To Hide/Show 56 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B5 (HOXB5) Antp homeobox family P09067
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
High mobility group protein B4 (HMGB4) HMGB family Q8WW32
Telomere zinc finger-associated protein (ZBTB48) Krueppel C2H2-type zinc-finger protein family P10074
Zinc finger and BTB domain-containing protein 16 (ZBTB16) Krueppel C2H2-type zinc-finger protein family Q05516
Zinc finger and BTB domain-containing protein 24 (ZBTB24) Krueppel C2H2-type zinc-finger protein family O43167
Zinc finger and BTB domain-containing protein 47 (ZBTB47) Krueppel C2H2-type zinc-finger protein family Q9UFB7
Zinc finger and BTB domain-containing protein 49 (ZBTB49) Krueppel C2H2-type zinc-finger protein family Q6ZSB9
Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) Krueppel C2H2-type zinc-finger protein family O43309
Zinc finger and SCAN domain-containing protein 21 (ZSCAN21) Krueppel C2H2-type zinc-finger protein family Q9Y5A6
Zinc finger and SCAN domain-containing protein 23 (ZSCAN23) Krueppel C2H2-type zinc-finger protein family Q3MJ62
Zinc finger protein 1 homolog (ZFP1) Krueppel C2H2-type zinc-finger protein family Q6P2D0
Zinc finger protein 136 (ZNF136) Krueppel C2H2-type zinc-finger protein family P52737
Zinc finger protein 140 (ZNF140) Krueppel C2H2-type zinc-finger protein family P52738
Zinc finger protein 148 (ZNF148) Krueppel C2H2-type zinc-finger protein family Q9UQR1
Zinc finger protein 165 (ZNF165) Krueppel C2H2-type zinc-finger protein family P49910
Zinc finger protein 169 (ZNF169) Krueppel C2H2-type zinc-finger protein family Q14929
Zinc finger protein 17 (ZNF17) Krueppel C2H2-type zinc-finger protein family P17021
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Zinc finger protein 227 (ZNF227) Krueppel C2H2-type zinc-finger protein family Q86WZ6
Zinc finger protein 239 (ZNF239) Krueppel C2H2-type zinc-finger protein family Q16600
Zinc finger protein 264 (ZNF264) Krueppel C2H2-type zinc-finger protein family O43296
Zinc finger protein 266 (ZNF266) Krueppel C2H2-type zinc-finger protein family Q14584
Zinc finger protein 302 (ZNF302) Krueppel C2H2-type zinc-finger protein family Q9NR11
Zinc finger protein 329 (ZNF329) Krueppel C2H2-type zinc-finger protein family Q86UD4
Zinc finger protein 35 (ZNF35) Krueppel C2H2-type zinc-finger protein family P13682
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 433 (ZNF433) Krueppel C2H2-type zinc-finger protein family Q8N7K0
Zinc finger protein 439 (ZNF439) Krueppel C2H2-type zinc-finger protein family Q8NDP4
Zinc finger protein 490 (ZNF490) Krueppel C2H2-type zinc-finger protein family Q9ULM2
Zinc finger protein 491 (ZNF491) Krueppel C2H2-type zinc-finger protein family Q8N8L2
Zinc finger protein 555 (ZNF555) Krueppel C2H2-type zinc-finger protein family Q8NEP9
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 578 (ZNF578) Krueppel C2H2-type zinc-finger protein family Q96N58
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 599 (ZNF599) Krueppel C2H2-type zinc-finger protein family Q96NL3
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger protein 669 (ZNF669) Krueppel C2H2-type zinc-finger protein family Q96BR6
Zinc finger protein 696 (ZNF696) Krueppel C2H2-type zinc-finger protein family Q9H7X3
Zinc finger protein 775 (ZNF775) Krueppel C2H2-type zinc-finger protein family Q96BV0
Zinc finger protein 777 (ZNF777) Krueppel C2H2-type zinc-finger protein family Q9ULD5
Zinc finger protein 785 (ZNF785) Krueppel C2H2-type zinc-finger protein family A8K8V0
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Zinc finger protein 860 (ZNF860) Krueppel C2H2-type zinc-finger protein family A6NHJ4
Hypermethylated in cancer 2 protein (HIC2) Krueppel C2H2-type zinc-finger protein family Q96JB3
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Teashirt homolog 3 (TSHZ3) Teashirt C2H2-type zinc-finger protein family Q63HK5
Bromodomain-containing protein 1 (BRD1) . O95696
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
Transcriptional repressor p66-beta (GATAD2B) . Q8WXI9
Zinc finger and BTB domain-containing protein 4 (ZBTB4) . Q9P1Z0
Zinc finger CCCH-type with G patch domain-containing protein (ZGPAT) . Q8N5A5
Zinc finger protein 202 (ZNF202) . O95125
Zinc finger protein 366 (ZNF366) . Q8N895
Zinc finger protein 408 (ZNF408) . Q9H9D4
Zinc finger protein 410 (ZNF410) . Q86VK4
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein Red (IK) RED family Q13123
Other
Click To Hide/Show 101 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
Ataxin-1 (ATXN1) ATXN1 family P54253
Protein BEX2 (BEX2) BEX family Q9BXY8
Breast cancer metastasis-suppressor 1 (BRMS1) BRMS1 family Q9HCU9
Breast cancer metastasis-suppressor 1-like protein (BRMS1L) BRMS1 family Q5PSV4
Bystin (BYSL) Bystin family Q13895
Caveolae-associated protein 3 (CAVIN3) CAVIN family Q969G5
Parafibromin (CDC73) CDC73 family Q6P1J9
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Coilin (COIL) Coilin family P38432
Splicing factor YJU2 (YJU2) CWC16 family Q9BW85
CWF19-like protein 2 (CWF19L2) CWF19 family Q2TBE0
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
ELL-associated factor 1 (EAF1) EAF family Q96JC9
Probable rRNA-processing protein EBP2 (EBNA1BP2) EBP2 family Q99848
Elongation factor Ts, mitochondrial (TSFM) EF-Ts family P43897
Eukaryotic translation initiation factor 3 subunit D (EIF3D) EIF-3 subunit D family O15371
Activator of basal transcription 1 (ABT1) ESF2/ABP1 family Q9ULW3
Large ribosomal subunit protein eL13 (RPL13) Eukaryotic ribosomal protein eL13 family P26373
Armadillo repeat-containing X-linked protein 1 (ARMCX1) Eutherian X-chromosome-specific Armcx family Q9P291
Protein FAM124A (FAM124A) FAM124 family Q86V42
Protein FAM13C (FAM13C) FAM13 family Q8NE31
Protein FAM133A (FAM133A) FAM133 family Q8N9E0
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM161B (FAM161B) FAM161 family Q96MY7
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Protein NipSnap homolog 3A (NIPSNAP3A) NipSnap family Q9UFN0
Ribosome biogenesis protein NOP53 (NOP53) NOP53 family Q9NZM5
Nucleolar and spindle-associated protein 1 (NUSAP1) NUSAP family Q9BXS6
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
PRKR-interacting protein 1 (PRKRIP1) PRKRIP1 family Q9H875
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Rhophilin-1 (RHPN1) RHPN family Q8TCX5
Nucleolar protein 12 (NOL12) RRP17 family Q9UGY1
Something about silencing protein 10 (UTP3) SAS10 family Q9NQZ2
Swi5-dependent recombination DNA repair protein 1 homolog (SFR1) SFR1/MEI5 family Q86XK3
Pre-mRNA-splicing factor SLU7 (SLU7) SLU7 family O95391
Small nuclear ribonucleoprotein Sm D2 (SNRPD2) SnRNP core protein family P62316
SNW domain-containing protein 1 (SNW1) SNW family Q13573
Sperm protein associated with the nucleus on the X chromosome N3 (SPANXN3) SPAN-X family Q5MJ09
Protein SSX3 (SSX3) SSX family Q99909
Synaptotagmin-17 (SYT17) Synaptotagmin family Q9BSW7
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
UPF0488 protein C8orf33 (C8orf33) UPF0488 family Q9H7E9
Probable U3 small nucleolar RNA-associated protein 11 (UTP11) UTP11 family Q9Y3A2
U3 small nucleolar RNA-associated protein 14 homolog C (UTP14C) UTP14 family Q5TAP6
U3 small nucleolar RNA-associated protein 25 homolog (UTP25) UTP25 family Q68CQ4
Vexin (VXN) Vexin family Q8TAG6
Bromodomain adjacent to zinc finger domain protein 2B (BAZ2B) WAL family Q9UIF8
A-kinase anchor protein 17A (AKAP17A) . Q02040
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Chromobox protein homolog 8 (CBX8) . Q9HC52
Cysteine-rich protein 2-binding protein (KAT14) . Q9H8E8
Deoxynucleotidyltransferase terminal-interacting protein 2 (DNTTIP2) . Q5QJE6
Elongin-A (ELOA) . Q14241
Emerin (EMD) . P50402
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
G patch domain-containing protein 2-like (GPATCH2L) . Q9NWQ4
G patch domain-containing protein 4 (GPATCH4) . Q5T3I0
GRIP and coiled-coil domain-containing protein 1 (GCC1) . Q96CN9
Inactive polyglycylase TTLL10 (TTLL10) . Q6ZVT0
INO80 complex subunit B (INO80B) . Q9C086
Interactor protein for cytohesin exchange factors 1 (IPCEF1) . Q8WWN9
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
KAT8 regulatory NSL complex subunit 1 (KANSL1) . Q7Z3B3
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Leukocyte receptor cluster member 8 (LENG8) . Q96PV6
Microspherule protein 1 (MCRS1) . Q96EZ8
Multiple myeloma tumor-associated protein 2 (MMTAG2) . Q9BU76
Nebulette (NEBL) . O76041
Nuclear receptor-interacting protein 1 (NRIP1) . P48552
Outer dynein arm-docking complex subunit 4 (ODAD4) . Q96NG3
Phostensin (PPP1R18) . Q6NYC8
Protein lin-37 homolog (LIN37) . Q96GY3
Protein phosphatase 1 regulatory inhibitor subunit 16B (PPP1R16B) . Q96T49
Protein PIMREG (PIMREG) . Q9BSJ6
Psoriasis susceptibility 1 candidate gene 2 protein (PSORS1C2) . Q9UIG4
Ras association domain-containing protein 10 (RASSF10) . A6NK89
Rho guanine nucleotide exchange factor 3 (ARHGEF3) . Q9NR81
RNA-binding protein 10 (RBM10) . P98175
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
Synaptotagmin-like protein 5 (SYTL5) . Q8TDW5
TAR DNA-binding protein 43 (TARDBP) . Q13148
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228
U4/U6 small nuclear ribonucleoprotein Prp3 (PRPF3) . O43395
Uncharacterized protein NKAPD1 (NKAPD1) . Q6ZUT1
Zinc finger CCHC domain-containing protein 10 (ZCCHC10) . Q8TBK6

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.