Details of the Target
General Information of Target
| Target ID | LDTP09222 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thiosulfate:glutathione sulfurtransferase (TSTD1) | |||||
| Gene Name | TSTD1 | |||||
| Gene ID | 100131187 | |||||
| Synonyms |
KAT; Thiosulfate:glutathione sulfurtransferase; TST; EC 2.8.1.- |
|||||
| 3D Structure | ||||||
| Sequence |
MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQ
ALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEKES |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region
|
|||||
| Function |
Thiosulfate:glutathione sulfurtransferase (TST) required to produce S-sulfanylglutathione (GSS(-)), a central intermediate in hydrogen sulfide metabolism. Provides the link between the first step in mammalian H(2)S metabolism performed by the sulfide:quinone oxidoreductase (SQOR) which catalyzes the conversion of H(2)S to thiosulfate, and the sulfur dioxygenase (SDO) which uses GSS(-) as substrate. The thermodynamic coupling of the irreversible SDO and reversible TST reactions provides a model for the physiologically relevant reaction with thiosulfate as the sulfane donor.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
 |
3.25 | LDD0066 | [1] | |
|
Probe 1 Probe Info |
 |
Y97(34.61) | LDD3495 | [2] | |
|
DBIA Probe Info |
 |
C86(1.78) | LDD3377 | [3] | |
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [4] | |
|
m-APA Probe Info |
 |
N.A. | LDD2231 | [4] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD2241 | [5] | |
|
NAIA_5 Probe Info |
 |
N.A. | LDD2223 | [6] | |
Competitor(s) Related to This Target
References