Details of the Target
General Information of Target
| Target ID | LDTP08959 | |||||
|---|---|---|---|---|---|---|
| Target Name | Casein kinase I isoform alpha-like (CSNK1A1L) | |||||
| Gene Name | CSNK1A1L | |||||
| Gene ID | 122011 | |||||
| Synonyms |
Casein kinase I isoform alpha-like; CKI-alpha-like; EC 2.7.11.1; CK1 |
|||||
| 3D Structure | ||||||
| Sequence |
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYE
SKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM ISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKH LIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKK MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, Casein kinase I subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C291(2.02); C277(1.77) | LDD3310 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C263(0.00); C249(0.00) | LDD0162 | [2] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [3] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C249(0.81) | LDD2187 | [4] |
| LDCM0572 | Fragment10 | Ramos | C249(0.90) | LDD2189 | [4] |
| LDCM0573 | Fragment11 | Ramos | C249(0.57) | LDD2190 | [4] |
| LDCM0574 | Fragment12 | Ramos | C249(0.80) | LDD2191 | [4] |
| LDCM0575 | Fragment13 | Ramos | C249(1.01) | LDD2192 | [4] |
| LDCM0576 | Fragment14 | Ramos | C249(0.45) | LDD2193 | [4] |
| LDCM0579 | Fragment20 | Ramos | C249(0.78) | LDD2194 | [4] |
| LDCM0580 | Fragment21 | Ramos | C249(0.76) | LDD2195 | [4] |
| LDCM0582 | Fragment23 | Ramos | C249(1.20) | LDD2196 | [4] |
| LDCM0578 | Fragment27 | Ramos | C249(0.90) | LDD2197 | [4] |
| LDCM0586 | Fragment28 | Ramos | C249(0.50) | LDD2198 | [4] |
| LDCM0588 | Fragment30 | Ramos | C249(1.11) | LDD2199 | [4] |
| LDCM0589 | Fragment31 | Ramos | C249(1.10) | LDD2200 | [4] |
| LDCM0590 | Fragment32 | Ramos | C249(0.70) | LDD2201 | [4] |
| LDCM0468 | Fragment33 | Ramos | C249(1.21) | LDD2202 | [4] |
| LDCM0596 | Fragment38 | Ramos | C249(0.93) | LDD2203 | [4] |
| LDCM0566 | Fragment4 | Ramos | C249(0.83) | LDD2184 | [4] |
| LDCM0610 | Fragment52 | Ramos | C249(1.24) | LDD2204 | [4] |
| LDCM0614 | Fragment56 | Ramos | C249(1.21) | LDD2205 | [4] |
| LDCM0569 | Fragment7 | Ramos | C249(1.05) | LDD2186 | [4] |
| LDCM0571 | Fragment9 | Ramos | C249(0.85) | LDD2188 | [4] |
| LDCM0022 | KB02 | Ramos | C249(0.57) | LDD2182 | [4] |
| LDCM0023 | KB03 | Ramos | C249(0.81) | LDD2183 | [4] |
| LDCM0024 | KB05 | COLO792 | C291(2.02); C277(1.77) | LDD3310 | [1] |
References




