Details of the Target
General Information of Target
| Target ID | LDTP08931 | |||||
|---|---|---|---|---|---|---|
| Target Name | Germinal center-associated signaling and motility protein (GCSAM) |
|
||||
| Gene Name | GCSAM | |||||
| Gene ID | 257144 | |||||
| Synonyms |
GAL; GCET2; Germinal center-associated signaling and motility protein; Germinal center B-cell-expressed transcript 2 protein; Germinal center-associated lymphoma protein; hGAL |
|||||
| 3D Structure | ||||||
| Sequence |
MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDS
QNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRES LGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Involved in the negative regulation of lymphocyte motility. It mediates the migration-inhibitory effects of IL6. Serves as a positive regulator of the RhoA signaling pathway. Enhancement of RhoA activation results in inhibition of lymphocyte and lymphoma cell motility by activation of its downstream effector ROCK. Is a regulator of B-cell receptor signaling, that acts through SYK kinase activation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
9.86 | LDD0433 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| AP-1 complex subunit mu-1 (AP1M1) | Adaptor complexes medium subunit family | Q9BXS5 | |||
Other
References