Details of the Target
General Information of Target
| Target ID | LDTP08788 | |||||
|---|---|---|---|---|---|---|
| Target Name | Rho GTPase-activating protein 24 (ARHGAP24) | |||||
| Gene Name | ARHGAP24 | |||||
| Gene ID | 83478 | |||||
| Synonyms |
FILGAP; Rho GTPase-activating protein 24; Filamin-A-associated RhoGAP; FilGAP; RAC1- and CDC42-specific GTPase-activating protein of 72 kDa; RC-GAP72; Rho-type GTPase-activating protein 24; RhoGAP of 73 kDa; Sarcoma antigen NY-SAR-88; p73RhoGAP
|
|||||
| 3D Structure | ||||||
| Sequence |
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI RRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPK VEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQN KENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNG TVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFS MMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDD LSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKI EYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK EMEQFFSTFGELTVEPRRTERGNTIWIQ |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CASKI | SNV: p.F583Y | . | |||
| CCK81 | SNV: p.S371G | . | |||
| CHL1 | SNV: p.D377N | . | |||
| EOL1 | SNV: p.C159S | . | |||
| FUOV1 | SNV: p.W36Ter | . | |||
| HS936T | SNV: p.D533Y | . | |||
| KYSE150 | SNV: p.V160M; p.S638N | . | |||
| MCC13 | SNV: p.E561K | . | |||
| MCC26 | SNV: p.Q187Ter; p.S602F | . | |||
| MEWO | SNV: p.R499Ter | DBIA Probe Info | |||
| MIAPACA2 | SNV: p.P11R | . | |||
| NCIH1155 | SNV: p.G30Ter | . | |||
| NCIH23 | SNV: p.L232W | . | |||
| OPM2 | SNV: p.R175Ter | . | |||
| RKO | Insertion: p.M722NfsTer50 | . | |||
| RL952 | SNV: p.R216Ter | . | |||
| RPMI8226 | Substitution: p.E9K | . | |||
| SBC5 | SNV: p.S563F | . | |||
| SW1990 | SNV: p.R216Ter | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
![]() |
C578(5.93); C75(3.63) | LDD0171 | [1] | |
|
DBIA Probe Info |
![]() |
C560(1.18); C571(1.18) | LDD0078 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C578(5.93); C75(3.63) | LDD0171 | [1] |
| LDCM0020 | ARS-1620 | HCC44 | C560(1.18); C571(1.18) | LDD0078 | [2] |
| LDCM0022 | KB02 | ICC108 | C234(2.17) | LDD2381 | [5] |
| LDCM0023 | KB03 | ICC108 | C374(2.19); C234(2.60) | LDD2798 | [5] |
| LDCM0024 | KB05 | UACC257 | C374(2.25) | LDD3325 | [5] |
The Interaction Atlas With This Target
References




