Details of the Target
General Information of Target
Target ID | LDTP08727 | |||||
---|---|---|---|---|---|---|
Target Name | Synaptonemal complex central element protein 1 (SYCE1) | |||||
Gene Name | SYCE1 | |||||
Gene ID | 93426 | |||||
Synonyms |
C10orf94; Synaptonemal complex central element protein 1; Cancer/testis antigen 76; CT76 |
|||||
3D Structure | ||||||
Sequence |
MAGRSLTSKAEPTAGAVDRAEKAGGQDTSSQKIEDLMEMVQKLQKVGSLEPRVEVLINRI
NEVQQAKKKANKDLGEARTICEALQKELDSLHGEKVHLKEILSKKQETLRILRLHCQEKE SEAHRKHTMLQECKERISALNLQIEEEKNKQRQLRLAFEEQLEDLMGQHKDLWDFHMPER LAKEICALDSSKEQLLKEEKLVKATLEDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATV QLFQEEHRKAEELLAAAAQRHQQLQQKCQQQQQKRQRLKEELEKHGMQVPAQAQSTQEEE AGPGDVASPKPLKGERPGAAHQAGPDVLIGQEDTLHPDLSPRGFQEIKELF |
|||||
Target Bioclass |
Other
|
|||||
Family |
SYCE family
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Requires SYCP1 in order to be incorporated into the central element. May have a role in the synaptonemal complex assembly, stabilization and recombination.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
IA-alkyne Probe Info |
![]() |
C268(1.08) | LDD2183 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C268(0.98) | LDD2187 | [1] |
LDCM0573 | Fragment11 | Ramos | C268(8.56) | LDD2190 | [1] |
LDCM0575 | Fragment13 | Ramos | C268(1.09) | LDD2192 | [1] |
LDCM0576 | Fragment14 | Ramos | C268(0.72) | LDD2193 | [1] |
LDCM0580 | Fragment21 | Ramos | C268(1.21) | LDD2195 | [1] |
LDCM0582 | Fragment23 | Ramos | C268(0.73) | LDD2196 | [1] |
LDCM0578 | Fragment27 | Ramos | C268(1.27) | LDD2197 | [1] |
LDCM0586 | Fragment28 | Ramos | C268(0.65) | LDD2198 | [1] |
LDCM0588 | Fragment30 | Ramos | C268(1.84) | LDD2199 | [1] |
LDCM0589 | Fragment31 | Ramos | C268(0.93) | LDD2200 | [1] |
LDCM0468 | Fragment33 | Ramos | C268(1.26) | LDD2202 | [1] |
LDCM0596 | Fragment38 | Ramos | C268(1.01) | LDD2203 | [1] |
LDCM0566 | Fragment4 | Ramos | C268(0.74) | LDD2184 | [1] |
LDCM0610 | Fragment52 | Ramos | C268(1.71) | LDD2204 | [1] |
LDCM0614 | Fragment56 | Ramos | C268(2.18) | LDD2205 | [1] |
LDCM0569 | Fragment7 | Ramos | C268(0.67) | LDD2186 | [1] |
LDCM0023 | KB03 | Ramos | C268(1.08) | LDD2183 | [1] |