Details of the Target

General Information of Target

Target ID LDTP08635
Target Name Interactor of HORMAD1 protein 1 (IHO1)
Gene Name IHO1
Gene ID 339834
Synonyms
CCDC36; Interactor of HORMAD1 protein 1; Cancer/testis antigen 74; CT74; Coiled-coil domain-containing protein 36
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNFNVWNIKEMLSIPSGSGNKKSSNWNNNQNDYSSLSDSQFLFGSQFCPENSETLSAPLD
FGAHLRHSKQSQQNYLEGEPSIFTKYQTKPQLFGGDIKDGGLFPPPLSVGKSKGLLEQFE
EKKKRAKDKCDSETLYNFVSNVRESILRLQTSVEKSEDHLSSRSQSILDSLETVAKTLQE
TIQAQNDLVFEAVQDKGNMEQAILEMKKRFEARQGEFIEMKSNLKHLEVLVAQQSQEFQQ
LCEQLGQLNVPSVLAELKRLISVPPVKDSASQTSPPLAQSLNLTRQEKYTSEKPVLWQAQ
ALPAAWNPGMGSLQPGEFDVWGEGAKNDDLQEEAALPAFGSHERNRHVKDKVVQTNCKNW
AVTKTGAKNHGSSVPGHKIPSDRDLVSQGASQLTSLEINFSTSIKNACQKYQAQSMFLCD
PREHLVIKQKDGTVEMRGKDKKQQPRKAHRAHRGRLIASKQKQIPIQTCKFNSKYQSPQP
AISVPQSPFLGQQEPRAQPLHLQCPRSPRKPVCPILGGTVMPNKTVRAVQGRLLQLSRCS
SQDNWLLSSSSQGDHQMSWFSDLNLGCSETPLCKEAGKNLLYDLGFDSSDDDGF
Target Bioclass
Other
Subcellular location
Chromosome
Function
Required for DNA double-strand breaks (DSBs) formation in unsynapsed regions during meiotic recombination. Probably acts by forming a complex with MEI4 and REC114, which activates DSBs formation in unsynapsed regions, an essential step to ensure completion of synapsis. Not required for HORMAD1 functions in pairing-independent synaptonemal complex formation, ATR recruitment to unsynapsed axes, meiotic silencing of unsynapsed chromatin (MSUC) or meiotic surveillance.
Uniprot ID
Q8IYA8
Ensemble ID
ENST00000296449.9
HGNC ID
HGNC:27945

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
G402 SNV: p.P495S .
HCT15 SNV: p.P265T .
NCIH1155 SNV: p.L393V .
SKMEL28 SNV: p.S262P .
SW620 Deletion: p.Q300RfsTer49 .
U937 SNV: p.H452Y .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
CY4
 Probe Info  		Q87(0.00); Q91(0.00)  LDD0247  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 20 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Cell division cycle protein 23 homolog (CDC23) APC8/CDC23 family Q9UJX2
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Neuroglobin (NGB) Globin family Q9NPG2
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Glycogen [starch] synthase, muscle (GYS1) Glycosyltransferase 3 family P13807
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Ubiquitin carboxyl-terminal hydrolase 20 (USP20) Peptidase C19 family Q9Y2K6
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Serine/threonine-protein kinase Nek6 (NEK6) NEK Ser/Thr protein kinase family Q9HC98
Serine/threonine-protein kinase 25 (STK25) STE Ser/Thr protein kinase family O00506
GTP-binding protein GEM (GEM) RGK family P55040
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Tripartite motif-containing protein 14 (TRIM14) TRIM/RBCC family Q14142
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
E3 ubiquitin-protein ligase FANCL (FANCL) . Q9NW38
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Rho-related BTB domain-containing protein 3 (RHOBTB3) . O94955
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Syntenin-1 (SDCBP) . O00560
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein with KRAB and SCAN domains 3 (ZKSCAN3) Krueppel C2H2-type zinc-finger protein family Q9BRR0
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor ligand superfamily member 6 (FASLG) Tumor necrosis factor family P48023
Other
Click To Hide/Show 25 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Abl interactor 2 (ABI2) ABI family Q9NYB9
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
Dynein light chain 1, cytoplasmic (DYNLL1) Dynein light chain family P63167
Dynein light chain 2, cytoplasmic (DYNLL2) Dynein light chain family Q96FJ2
Protein FAM124A (FAM124A) FAM124 family Q86V42
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Protein HEXIM2 (HEXIM2) HEXIM family Q96MH2
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
MORF4 family-associated protein 1-like 1 (MRFAP1L1) MORF4 family-associated protein family Q96HT8
DNA repair protein RAD51 homolog 4 (RAD51D) RecA family O75771
Tetratricopeptide repeat protein 19, mitochondrial (TTC19) TTC19 family Q6DKK2
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
EF-hand domain-containing protein 1 (EFHC1) . Q5JVL4
Four and a half LIM domains protein 3 (FHL3) . Q13643
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 11 (KLHL11) . Q9NVR0
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Melanoma-associated antigen B4 (MAGEB4) . O15481
PRKCA-binding protein (PICK1) . Q9NRD5
Proline-rich protein 34 (PRR34) . Q9NV39
Rhombotin-2 (LMO2) . P25791

References

1 Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.