Details of the Target

General Information of Target

Target ID LDTP08479
Target Name Transmembrane protein 139 (TMEM139)
Gene Name TMEM139
Gene ID 135932
Synonyms
Transmembrane protein 139
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVPMHLLGRLEKPLLLLCCASFLLGLALLGIKTDITPVAYFFLTLGGFFLFAYLLVRFLE
WGLRSQLQSMQTESPGPSGNARDNEAFEVPVYEEAVVGLESQCRPQELDQPPPYSTVVIP
PAPEEEQPSHPEGSRRAKLEQRRMASEGSMAQEGSPGRAPINLRLRGPRAVSTAPDLQSL
AAVPTLEPLTPPPAYDVCFGHPDDDSVFYEDNWAPP
Target Bioclass
Transporter and channel
Subcellular location
Membrane
Function May be involved in cellular trafficking of proteins such as SLC4A1.
Uniprot ID
Q8IV31
Ensemble ID
ENST00000359333.8
HGNC ID
HGNC:22058

Probe(s) Labeling This Target

PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DFG-out-4
 Probe Info  		0.00  LDD0075  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0017  DFG-out-2 A431 0.00  LDD0075  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Phosphatidylserine lipase ABHD16A (ABHD16A) ABHD16 family O95870
Phosphatidate cytidylyltransferase 2 (CDS2) CDS family O95674
Cytochrome b5 type B (CYB5B) Cytochrome b5 family O43169
Phospholipid phosphatase 4 (PLPP4) PA-phosphatase related phosphoesterase family Q5VZY2
Fatty acid hydroxylase domain-containing protein 2 (FAXDC2) Sterol desaturase family Q96IV6
UbiA prenyltransferase domain-containing protein 1 (UBIAD1) UbiA prenyltransferase family Q9Y5Z9
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
E3 ubiquitin-protein ligase MARCHF5 (MARCHF5) . Q9NX47
E3 ubiquitin-protein ligase NEDD4 (NEDD4) . P46934
Transporter and channel
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 2 (BCL2L2) Bcl-2 family Q92843
Proton-coupled zinc antiporter SLC30A8 (SLC30A8) Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family Q8IWU4
Lens fiber major intrinsic protein (MIP) MIP/aquaporin (TC 1.A.8) family P30301
CMP-sialic acid transporter (SLC35A1) Nucleotide-sugar transporter family P78382
Peripheral myelin protein 22 (PMP22) PMP-22/EMP/MP20 family Q01453
CD151 antigen (CD151) Tetraspanin (TM4SF) family P48509
Uroplakin-1b (UPK1B) Tetraspanin (TM4SF) family O75841
Potassium channel subfamily K member 1 (KCNK1) Two pore domain potassium channel (TC 1.A.1.8) family O00180
Ceroid-lipofuscinosis neuronal protein 6 (CLN6) . Q9NWW5
Transmembrane protein 60 (TMEM60) . Q9H2L4
Other
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein L2 (APOL2) Apolipoprotein L family Q9BQE5
MAL-like protein (MALL) MAL family Q13021
Ninjurin-2 (NINJ2) Ninjurin family Q9NZG7
Neuronal vesicle trafficking-associated protein 1 (NSG1) NSG family P42857
Protein NKG7 (NKG7) PMP-22/EMP/MP20 family Q16617
Single-pass membrane and coiled-coil domain-containing protein 4 (SMCO4) SMCO4 family Q9NRQ5
Beta-soluble NSF attachment protein (NAPB) SNAP family Q9H115
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Vesicle-trafficking protein SEC22b (SEC22B) Synaptobrevin family O75396
Transmembrane protein 120B (TMEM120B) TMEM120 family A0PK00
Transmembrane protein 19 (TMEM19) TMEM19 family Q96HH6
Transcriptional coactivator YAP1 (YAP1) YAP1 family P46937
Protein YIF1A (YIF1A) YIF1 family O95070
Zinc finger protein-like 1 (ZFPL1) ZFPL1 family O95159
Pulmonary surfactant-associated protein C (SFTPC) . P11686
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228
Transmembrane protein 107 (TMEM107) . Q6UX40

References

1 Affinity-based probes based on type II kinase inhibitors. J Am Chem Soc. 2012 Nov 21;134(46):19017-25. doi: 10.1021/ja306035v. Epub 2012 Nov 6.