Details of the Target
General Information of Target
| Target ID | LDTP08223 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sodium/hydrogen exchanger 9B2 (SLC9B2) | |||||
| Gene Name | SLC9B2 | |||||
| Gene ID | 133308 | |||||
| Synonyms |
NHA2; NHEDC2; Sodium/hydrogen exchanger 9B2; Na(+)/H(+) exchanger NHA2; Na(+)/H(+) exchanger-like domain-containing protein 2; NHE domain-containing protein 2; Sodium/hydrogen exchanger-like domain-containing protein 2; Solute carrier family 9 subfamily B member 2
|
|||||
| 3D Structure | ||||||
| Sequence |
MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQ
ETPTEANHVQRLRQMLACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIII LFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIA LSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFV LGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFP GSGGLCTLVMAFLAGMGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGL CVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGE KQLEDYGMDVLTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNKDEEVQGETSVQV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Electroneutral Na(+) Li(+)/H(+) antiporter that extrudes Na(+) or Li(+) in exchange for external protons across the membrane. Uses the proton gradient/membrane potential to extrude sodium. Contributes to the regulation of intracellular pH and sodium homeostasis. Also able to mediate Na(+)/Li(+) antiporter activity in kidney. May play a physiological role in renal tubular function and blood pressure homeostasis. Plays an important role for insulin secretion and clathrin-mediated endocytosis in beta-cells. Involved in sperm motility and fertility. It is controversial whether SLC9B2 plays a role in osteoclast differentiation or not.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY4 Probe Info |
![]() |
S454(0.00); W457(0.00) | LDD0247 | [1] | |
The Interaction Atlas With This Target

