General Information of Target

Target ID LDTP08200
Target Name Cysteine protease ATG4D (ATG4D)
Gene Name ATG4D
Gene ID 84971
Synonyms
APG4D; AUTL4; Cysteine protease ATG4D; EC 3.4.22.-; AUT-like 4 cysteine endopeptidase; Autophagy-related cysteine endopeptidase 4; Autophagin-4; Autophagy-related protein 4 homolog D; HsAPG4D) [Cleaved into: Cysteine protease ATG4D, mitochondrial]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPD
EVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRL
WLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELS
GSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSG
KKAGDWYGPSLVAHILRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSV
VILVPVRLGGETLNPVYVPCVKELLRCELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYC
QPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETLCSELTRVLSSSS
ATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
Target Bioclass
Enzyme
Family
Peptidase C54 family
Subcellular location
Cytoplasm
Function
[Cysteine protease ATG4D]: Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins. The protease activity is required for proteolytic activation of ATG8 family proteins: cleaves the C-terminal amino acid of ATG8 proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. In addition to the protease activity, also mediates delipidation of ATG8 family proteins. Catalyzes delipidation of PE-conjugated forms of ATG8 proteins during macroautophagy. Also involved in non-canonical autophagy, a parallel pathway involving conjugation of ATG8 proteins to single membranes at endolysosomal compartments, by catalyzing delipidation of ATG8 proteins conjugated to phosphatidylserine (PS). ATG4D plays a role in the autophagy-mediated neuronal homeostasis in the central nervous system. Compared to other members of the family (ATG4A, ATG4B or ATG4C), constitutes the major protein for the delipidation activity, while it promotes weak proteolytic activation of ATG8 proteins. Involved in phagophore growth during mitophagy independently of its protease activity and of ATG8 proteins: acts by regulating ATG9A trafficking to mitochondria and promoting phagophore-endoplasmic reticulum contacts during the lipid transfer phase of mitophagy.; [Cysteine protease ATG4D, mitochondrial]: Plays a role as an autophagy regulator that links mitochondrial dysfunction with apoptosis. The mitochondrial import of ATG4D during cellular stress and differentiation may play important roles in the regulation of mitochondrial physiology, ROS, mitophagy and cell viability.
Uniprot ID
Q86TL0
Ensemble ID
ENST00000309469.9
HGNC ID
HGNC:20789

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
G361 SNV: p.P226L .
HCT15 Deletion: p.R224GfsTer28 .
KMS27 SNV: p.N74K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C263(0.72)  LDD1508  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0215  AC10 HEK-293T C263(0.72)  LDD1508  [1]
 LDCM0259  AC14 HEK-293T C263(1.07)  LDD1512  [1]
 LDCM0277  AC18 HEK-293T C263(0.70)  LDD1516  [1]
 LDCM0279  AC2 HEK-293T C263(1.09)  LDD1518  [1]
 LDCM0282  AC22 HEK-293T C263(0.97)  LDD1521  [1]
 LDCM0286  AC26 HEK-293T C263(0.69)  LDD1525  [1]
 LDCM0291  AC30 HEK-293T C263(0.84)  LDD1530  [1]
 LDCM0295  AC34 HEK-293T C263(1.03)  LDD1534  [1]
 LDCM0299  AC38 HEK-293T C263(0.93)  LDD1538  [1]
 LDCM0304  AC42 HEK-293T C263(0.94)  LDD1543  [1]
 LDCM0308  AC46 HEK-293T C263(0.87)  LDD1547  [1]
 LDCM0313  AC50 HEK-293T C263(0.65)  LDD1552  [1]
 LDCM0317  AC54 HEK-293T C263(0.90)  LDD1556  [1]
 LDCM0321  AC58 HEK-293T C263(1.18)  LDD1560  [1]
 LDCM0323  AC6 HEK-293T C263(1.13)  LDD1562  [1]
 LDCM0326  AC62 HEK-293T C263(1.04)  LDD1565  [1]
 LDCM0368  CL10 HEK-293T C263(0.90)  LDD1572  [1]
 LDCM0372  CL103 HEK-293T C263(0.74)  LDD1576  [1]
 LDCM0376  CL107 HEK-293T C263(0.83)  LDD1580  [1]
 LDCM0381  CL111 HEK-293T C263(0.80)  LDD1585  [1]
 LDCM0385  CL115 HEK-293T C263(1.00)  LDD1589  [1]
 LDCM0389  CL119 HEK-293T C263(1.03)  LDD1593  [1]
 LDCM0394  CL123 HEK-293T C263(0.73)  LDD1598  [1]
 LDCM0398  CL127 HEK-293T C263(0.84)  LDD1602  [1]
 LDCM0402  CL15 HEK-293T C263(0.95)  LDD1606  [1]
 LDCM0405  CL18 HEK-293T C263(0.66)  LDD1609  [1]
 LDCM0410  CL22 HEK-293T C263(0.93)  LDD1614  [1]
 LDCM0415  CL27 HEK-293T C263(0.74)  LDD1619  [1]
 LDCM0418  CL3 HEK-293T C263(0.83)  LDD1622  [1]
 LDCM0419  CL30 HEK-293T C263(1.19)  LDD1623  [1]
 LDCM0423  CL34 HEK-293T C263(0.91)  LDD1627  [1]
 LDCM0428  CL39 HEK-293T C263(0.65)  LDD1632  [1]
 LDCM0432  CL42 HEK-293T C263(1.03)  LDD1636  [1]
 LDCM0436  CL46 HEK-293T C263(0.96)  LDD1640  [1]
 LDCM0445  CL54 HEK-293T C263(0.88)  LDD1648  [1]
 LDCM0449  CL58 HEK-293T C263(1.09)  LDD1652  [1]
 LDCM0451  CL6 HEK-293T C263(1.20)  LDD1654  [1]
 LDCM0455  CL63 HEK-293T C263(0.70)  LDD1658  [1]
 LDCM0458  CL66 HEK-293T C263(1.22)  LDD1661  [1]
 LDCM0463  CL70 HEK-293T C263(0.94)  LDD1666  [1]
 LDCM0471  CL78 HEK-293T C263(0.85)  LDD1674  [1]
 LDCM0476  CL82 HEK-293T C263(0.87)  LDD1679  [1]
 LDCM0481  CL87 HEK-293T C263(1.20)  LDD1684  [1]
 LDCM0485  CL90 HEK-293T C263(0.90)  LDD1688  [1]
 LDCM0489  CL94 HEK-293T C263(1.35)  LDD1692  [1]
 LDCM0494  CL99 HEK-293T C263(1.39)  LDD1697  [1]
 LDCM0495  E2913 HEK-293T C263(0.99)  LDD1698  [1]
 LDCM0468  Fragment33 HEK-293T C263(0.82)  LDD1671  [1]

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402