Details of the Target

General Information of Target

Target ID LDTP08133
Target Name Transcription factor AP-2-delta (TFAP2D)
Gene Name TFAP2D
Gene ID 83741
Synonyms
TFAP2BL1; Transcription factor AP-2-delta; AP2-delta; Activating enhancer-binding protein 2-delta; Transcription factor AP-2-beta-like 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASPYF
STNHQYTPLHHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQIHHGEPTDFINLHNAR
ALKSSCLDEQRRELGCLDAYRRHDLSLMSHGSQYGMHPDQRLLPGPSLGLAAAGADDLQG
SVEAQCGLVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSP
PECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHL
ARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQDLLSQDRSPLG
SSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGA
ADSGQGHANSEKAPLRKTSEAAVKEGKTEKTD
Target Bioclass
Transcription factor
Family
AP-2 family
Subcellular location
Nucleus
Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC.
Uniprot ID
Q7Z6R9
Ensemble ID
ENST00000008391.4
HGNC ID
HGNC:15581

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
MPP-AC
 Probe Info  		N.A.  LDD0428  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Anterior gradient protein 2 homolog (AGR2) AGR family O95994
Casein kinase II subunit beta (CSNK2B) Casein kinase 2 subunit beta family P67870
Glycogen [starch] synthase, muscle (GYS1) Glycosyltransferase 3 family P13807
Proteasome subunit beta type-4 (PSMB4) Peptidase T1B family P28070
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) CAMK Ser/Thr protein kinase family Q9UQM7
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
Helicase ARIP4 (RAD54L2) SNF2/RAD54 helicase family Q9Y4B4
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Other
Click To Hide/Show 37 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
A-kinase anchor protein 8-like (AKAP8L) AKAP95 family Q9ULX6
Cysteine-rich DPF motif domain-containing protein 1 (CDPF1) CDPF1 family Q6NVV7
Centrosomal protein of 76 kDa (CEP76) CEP76 family Q8TAP6
Cornifelin (CNFN) Cornifelin family Q9BYD5
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA mismatch repair protein Mlh1 (MLH1) DNA mismatch repair MutL/HexB family P40692
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 19-2 (KRTAP19-2) KRTAP type 19 family Q3LHN2
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 2-4 (KRTAP2-4) KRTAP type 2 family Q9BYR9
Keratin-associated protein 6-1 (KRTAP6-1) KRTAP type 6 family Q3LI64
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 7-1 (KRTAP7-1) KRTAP type 7 family Q8IUC3
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Protein Mis18-beta (OIP5) Mis18 family O43482
Keratin-associated protein 11-1 (KRTAP11-1) PMG family Q8IUC1
Keratin-associated protein 15-1 (KRTAP15-1) PMG family Q3LI76
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
SLAIN motif-containing protein 1 (SLAIN1) SLAIN motif-containing family Q8ND83
Protein sprouty homolog 1 (SPRY1) Sprouty family O43609
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
BAG family molecular chaperone regulator 4 (BAG4) . O95429
Caspase recruitment domain-containing protein 10 (CARD10) . Q9BWT7
Keratinocyte proline-rich protein (KPRP) . Q5T749
Protein SPMIP9 (SPMIP9) . Q96LM6
Puratrophin-1 (PLEKHG4) . Q58EX7
TNF receptor-associated factor 1 (TRAF1) . Q13077
Zinc finger MYND domain-containing protein 12 (ZMYND12) . Q9H0C1

References

1 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.