Details of the Target

General Information of Target

Target ID LDTP08090
Target Name Golgin subfamily A member 7 (GOLGA7)
Gene Name GOLGA7
Gene ID 51125
Synonyms
GCP16; Golgin subfamily A member 7; Golgi complex-associated protein of 16 kDa
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKL
GGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
RVIEITIYEDRGMSSGR
Target Bioclass
Transporter and channel
Family
ERF4 family
Subcellular location
Golgi apparatus membrane
Function May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Uniprot ID
Q7Z5G4
Ensemble ID
ENST00000357743.9
HGNC ID
HGNC:24876

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 SNV: p.R40G .
CCSW1 SNV: p.R16P .
DU145 SNV: p.A71V .
LNCaP clone FGC SNV: p.R40M .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 7 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
BTD
 Probe Info  		C24(1.37)  LDD2104  [1]
IPM
 Probe Info  		C24(13.56)  LDD1701  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0162  [2]
WYneN
 Probe Info  		N.A.  LDD0021  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [4]
AOyne
 Probe Info  		14.20  LDD0443  [5]
NAIA_5
 Probe Info  		N.A.  LDD2223  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0519  1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one MDA-MB-231 C24(0.81)  LDD2112  [1]
 LDCM0625  F8 Ramos C24(1.26)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C24(2.06)  LDD2189  [7]
 LDCM0574  Fragment12 Ramos C24(2.18)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C24(0.40)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos C24(0.97)  LDD2193  [7]
 LDCM0580  Fragment21 Ramos C24(0.68)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C24(0.55)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C24(0.52)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos C24(0.50)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C24(0.98)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C24(0.76)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C24(1.41)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C24(0.75)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C24(0.78)  LDD2203  [7]
 LDCM0610  Fragment52 Ramos C24(0.74)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C24(0.89)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos C24(2.60)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C24(2.02)  LDD2188  [7]
 LDCM0022  KB02 Ramos C24(2.67)  LDD2182  [7]
 LDCM0023  KB03 MDA-MB-231 C24(13.56)  LDD1701  [1]
 LDCM0024  KB05 Ramos C24(4.38)  LDD2185  [7]
 LDCM0511  Nucleophilic fragment 18b MDA-MB-231 C24(1.37)  LDD2104  [1]
 LDCM0547  Nucleophilic fragment 41 MDA-MB-231 C24(0.54)  LDD2141  [1]
 LDCM0627  NUDT7-COV-1 HEK-293T C24(1.08)  LDD2206  [8]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-2 (ACTN2) Alpha-actinin family P35609
Calsenilin (KCNIP3) Recoverin family Q9Y2W7
Kv channel-interacting protein 4 (KCNIP4) Recoverin family Q6PIL6
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein FAM72D (FAM72D) FAM72 family Q6L9T8
LRP chaperone MESD (MESD) MESD family Q14696
Neurocalcin-delta (NCALD) Recoverin family P61601

References

1 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
8 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.