Details of the Target

General Information of Target

Target ID LDTP08043
Target Name Keratin, type I cytoskeletal 27 (KRT27)
Gene Name KRT27
Gene ID 342574
Synonyms
KRT25C; Keratin, type I cytoskeletal 27; Cytokeratin-27; CK-27; Keratin-25C; K25C; Keratin-27; K27; Type I inner root sheath-specific keratin-K25irs3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGG
GLGGGSASCAAFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWY
EKFGPGSCRGLDHDYSRYFPIIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENE
LALHQSVEADINGLRRVLDELTLCRTDLEIQLETLSEELAYLKKNHEEEMKALQCAAGGN
VNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISDDAGATTSA
RNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQV
RTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS
Target Bioclass
Other
Family
Intermediate filament family
Subcellular location
Cytoplasm
Function Essential for the proper assembly of type I and type II keratin protein complexes and formation of keratin intermediate filaments in the inner root sheath (irs).
Uniprot ID
Q7Z3Y8
Ensemble ID
ENST00000301656.4
HGNC ID
HGNC:30841

Probe(s) Labeling This Target

PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Dasatinib-CA-8PAP
 Probe Info  		N.A.  LDD0364  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0097  Dasatinib K562 N.A.  LDD0364  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
26S proteasome regulatory subunit 8 (PSMC5) AAA ATPase family P62195
FAST kinase domain-containing protein 4 (TBRG4) FAST kinase family Q969Z0
Protein N-terminal glutamine amidohydrolase (NTAQ1) NTAQ1 family Q96HA8
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Dual specificity protein phosphatase 26 (DUSP26) Protein-tyrosine phosphatase family Q9BV47
Myotubularin-related protein 9 (MTMR9) Protein-tyrosine phosphatase family Q96QG7
Exosome complex component RRP46 (EXOSC5) RNase PH family Q9NQT4
Thioredoxin, mitochondrial (TXN2) Thioredoxin family Q99757
V-type proton ATPase subunit D (ATP6V1D) V-ATPase D subunit family Q9Y5K8
Coiled-coil domain-containing protein 68 (CCDC68) . Q9H2F9
Josephin-1 (JOSD1) . Q15040
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
RING finger protein 39 (RNF39) . Q9H2S5
Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D (SSC5D) . A1L4H1
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Coiled-coil domain-containing protein 22 (CCDC22) CCDC22 family O60826
WASH complex subunit 3 (WASHC3) CCDC53 family Q9Y3C0
Cytochrome c oxidase subunit 5B, mitochondrial (COX5B) Cytochrome c oxidase subunit 5B family P10606
Organic cation/carnitine transporter 2 (SLC22A5) Organic cation transporter (TC 2.A.1.19) family O76082
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Pinin (PNN) Pinin family Q9H307
SNARE-associated protein Snapin (SNAPIN) SNAPIN family O95295
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B9 (HOXB9) Abd-B homeobox family P17482
Zinc finger protein 3 (ZNF3) Krueppel C2H2-type zinc-finger protein family P17036
Zinc finger protein 669 (ZNF669) Krueppel C2H2-type zinc-finger protein family Q96BR6
Zinc finger protein 80 (ZNF80) Krueppel C2H2-type zinc-finger protein family P51504
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
THAP domain-containing protein 7 (THAP7) . Q9BT49
Transcriptional enhancer factor TEF-3 (TEAD4) . Q15561
Zinc finger protein 580 (ZNF580) . Q9UK33
Zinc finger protein 581 (ZNF581) . Q9P0T4
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Semaphorin-4C (SEMA4C) Semaphorin family Q9C0C4
Other
Click To Hide/Show 77 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein BEX2 (BEX2) BEX family Q9BXY8
Cilia- and flagella-associated protein 58 (CFAP58) CFAP58 family Q5T655
Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1) Complex I LYR family A6NFY7
Cyclin-C (CCNC) Cyclin family P24863
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 (GNG13) G protein gamma family Q9P2W3
Protein Hook homolog 3 (HOOK3) Hook family Q86VS8
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb2 (KRT82) Intermediate filament family Q9NSB4
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 1b (KRT77) Intermediate filament family Q7Z794
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 5 (KRT5) Intermediate filament family P13647
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6B (KRT6B) Intermediate filament family P04259
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 72 (KRT72) Intermediate filament family Q14CN4
Keratin, type II cytoskeletal 74 (KRT74) Intermediate filament family Q7RTS7
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Peripherin (PRPH) Intermediate filament family P41219
Phakinin (BFSP2) Intermediate filament family Q13515
Methyl-CpG-binding domain protein 3-like 2 (MBD3L2) MBD3L family Q8NHZ7
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Protein Mis18-beta (OIP5) Mis18 family O43482
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
Exocyst complex component 3-like protein (EXOC3L1) SEC6 family Q86VI1
SAGA-associated factor 29 (SGF29) SGF29 family Q96ES7
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Protein SSX3 (SSX3) SSX family Q99909
Suppressor of fused homolog (SUFU) SUFU family Q9UMX1
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Testis-specific protein TEX28 (TEX28; TEX28P1; TEX28P2) TEX28 family O15482
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Vacuolar protein sorting-associated protein 37C (VPS37C) VPS37 family A5D8V6
DNA repair protein XRCC4 (XRCC4) XRCC4-XLF family Q13426
Alanine and arginine-rich domain-containing protein (AARD) . Q4LEZ3
Arfaptin-1 (ARFIP1) . P53367
Centrosomal protein of 95 kDa (CEP95) . Q96GE4
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
Developmental pluripotency-associated protein 3 (DPPA3) . Q6W0C5
G protein pathway suppressor 2 (GPS2) . Q13227
Golgin subfamily A member 1 (GOLGA1) . Q92805
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Kelch-like protein 38 (KLHL38) . Q2WGJ6
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Lamin tail domain-containing protein 2 (LMNTD2) . Q8IXW0
Matrin-3 (MATR3) . P43243
MORN repeat-containing protein 4 (MORN4) . Q8NDC4
NADH dehydrogenase 1 alpha subcomplex assembly factor 3 (NDUFAF3) . Q9BU61
Outer dynein arm-docking complex subunit 3 (ODAD3) . A5D8V7
Phostensin (PPP1R18) . Q6NYC8
Protocadherin beta-14 (PCDHB14) . Q9Y5E9
RAS protein activator like-3 (RASAL3) . Q86YV0
Receptor-transporting protein 5 (RTP5) . Q14D33
Rho guanine nucleotide exchange factor 6 (ARHGEF6) . Q15052
RNA-binding protein 41 (RBM41) . Q96IZ5
SRA stem-loop-interacting RNA-binding protein, mitochondrial (SLIRP) . Q9GZT3
Testis-specific serine kinase substrate (TSKS) . Q9UJT2
TRAF3-interacting JNK-activating modulator (TRAF3IP3) . Q9Y228
Tubulin epsilon and delta complex protein 2 (TEDC2) . Q7L2K0

References

1 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.