Details of the Target
General Information of Target
Target ID | LDTP07981 | |||||
---|---|---|---|---|---|---|
Target Name | MOB kinase activator 1B (MOB1B) | |||||
Gene Name | MOB1B | |||||
Gene ID | 92597 | |||||
Synonyms |
MOB4A; MOBKL1A; MOB kinase activator 1B; Mob1 homolog 1A; Mob1A; Mob1B; Mps one binder kinase activator-like 1A |
|||||
3D Structure | ||||||
Sequence |
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVN
TVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMT WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLN TSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
|||||
Target Bioclass |
Other
|
|||||
Family |
MOB1/phocein family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Activator of LATS1/2 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Stimulates the kinase activity of STK38L.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C-Sul Probe Info |
![]() |
2.94 | LDD0066 | [1] | |
STPyne Probe Info |
![]() |
K30(20.00) | LDD2217 | [2] | |
HHS-465 Probe Info |
![]() |
Y95(10.00) | LDD2237 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0221 | [4] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [5] | |
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [6] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
WASH complex subunit 3 (WASHC3) | CCDC53 family | Q9Y3C0 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
TNFAIP3-interacting protein 1 (TNIP1) | . | Q15025 |
References