Details of the Target

General Information of Target

Target ID LDTP07796
Target Name Zinc finger protein 497 (ZNF497)
Gene Name ZNF497
Gene ID 162968
Synonyms
Zinc finger protein 497
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MESPRGWTLQVAPEEGQVLCNVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQAT
LGAADEQGGPGRELGPADGGRDGAGPRSEPADRALRPSPLPEEPGCRCGECGKAFSQGSY
LLQHRRVHTGEKPYTCPECGKAFAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQLIHH
QETHSGLKPFRCPDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRVH
TGARPHACRDCGKAFSQSSNLAEHLKIHAGARPHACPDCGKAFVRVAGLRQHRRTHSSEK
PFPCAECGKAFRESSQLLQHQRTHTGERPFECAECGQAFVMGSYLAEHRRVHTGEKPHAC
AQCGKAFSQRSNLLSHRRTHSGAKPFACADCGKAFRGSSGLAHHRLSHTGERPFACAECG
KAFRGSSELRQHQRLHSGERPFVCAHCSKAFVRKSELLSHRRTHTGERPYACGECGKPFS
HRCNLNEHQKRHGGRAAP
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
Q6ZNH5
Ensemble ID
ENST00000311044.8
HGNC ID
HGNC:23714

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C483(1.07)  LDD1510  [1]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0237  AC12 HEK-293T C483(1.07)  LDD1510  [1]
 LDCM0280  AC20 HEK-293T C483(1.03)  LDD1519  [1]
 LDCM0288  AC28 HEK-293T C483(1.01)  LDD1527  [1]
 LDCM0297  AC36 HEK-293T C483(0.95)  LDD1536  [1]
 LDCM0301  AC4 HEK-293T C483(0.87)  LDD1540  [1]
 LDCM0306  AC44 HEK-293T C483(0.99)  LDD1545  [1]
 LDCM0315  AC52 HEK-293T C483(1.04)  LDD1554  [1]
 LDCM0324  AC60 HEK-293T C483(0.87)  LDD1563  [1]
 LDCM0408  CL20 HEK-293T C483(2.40)  LDD1612  [1]
 LDCM0421  CL32 HEK-293T C483(2.31)  LDD1625  [1]
 LDCM0434  CL44 HEK-293T C483(2.15)  LDD1638  [1]
 LDCM0447  CL56 HEK-293T C483(1.90)  LDD1650  [1]
 LDCM0460  CL68 HEK-293T C483(2.03)  LDD1663  [1]
 LDCM0473  CL8 HEK-293T C483(4.05)  LDD1676  [1]
 LDCM0474  CL80 HEK-293T C483(1.76)  LDD1677  [1]
 LDCM0487  CL92 HEK-293T C483(1.60)  LDD1690  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cathepsin D (CTSD) Peptidase A1 family P07339
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Tyrosine-protein phosphatase non-receptor type 21 (PTPN21) Protein-tyrosine phosphatase family Q16825
Tensin-2 (TNS2) PTEN phosphatase protein family Q63HR2
Ribose-phosphate pyrophosphokinase 1 (PRPS1) Ribose-phosphate pyrophosphokinase family P60891
Sulfotransferase 2B1 (SULT2B1) Sulfotransferase 1 family O00204
E3 ubiquitin-protein ligase TRIM41 (TRIM41) TRIM/RBCC family Q8WV44
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
MyoD family inhibitor (MDFI) MDFI family Q99750
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Endothelial zinc finger protein induced by tumor necrosis factor alpha (ZNF71) Krueppel C2H2-type zinc-finger protein family Q9NQZ8
Zinc finger protein 473 (ZNF473) Krueppel C2H2-type zinc-finger protein family Q8WTR7
Zinc finger protein 526 (ZNF526) Krueppel C2H2-type zinc-finger protein family Q8TF50
Zinc finger protein 792 (ZNF792) Krueppel C2H2-type zinc-finger protein family Q3KQV3
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Zinc finger protein 837 (ZNF837) Krueppel C2H2-type zinc-finger protein family Q96EG3
Transcriptional regulator protein Pur-beta (PURB) PUR DNA-binding protein family Q96QR8
Zinc finger and BTB domain-containing protein 8A (ZBTB8A) . Q96BR9
Other
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Segment polarity protein dishevelled homolog DVL-3 (DVL3) DSH family Q92997
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Progranulin (GRN) Granulin family P28799
Prelamin-A/C (LMNA) Intermediate filament family P02545
KH domain-containing, RNA-binding, signal transduction-associated protein 2 (KHDRBS2) KHDRBS family Q5VWX1
Keratin-associated protein 1-1 (KRTAP1-1) KRTAP type 1 family Q07627
Keratin-associated protein 1-3 (KRTAP1-3) KRTAP type 1 family Q8IUG1
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-2 (KRTAP12-2) KRTAP type 12 family P59991
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 4-12 (KRTAP4-12) KRTAP type 4 family Q9BQ66
Keratin-associated protein 4-4 (KRTAP4-4) KRTAP type 4 family Q9BYR3
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Colorectal mutant cancer protein (MCC) MCC family P23508
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Oxysterol-binding protein-related protein 3 (OSBPL3) OSBP family Q9H4L5
Brorin (VWC2) . Q2TAL6
Merlin (NF2) . P35240
PRKCA-binding protein (PICK1) . Q9NRD5
RING finger protein 11 (RNF11) . Q9Y3C5
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402