Details of the Target
General Information of Target
| Target ID | LDTP07792 | |||||
|---|---|---|---|---|---|---|
| Target Name | Lysophospholipid acyltransferase 1 (MBOAT1) | |||||
| Gene Name | MBOAT1 | |||||
| Gene ID | 154141 | |||||
| Synonyms |
OACT1; Lysophospholipid acyltransferase 1; LPLAT 1; 1-acylglycerophosphocholine O-acyltransferase; EC 2.3.1.23; 1-acylglycerophosphoethanolamine O-acyltransferase; EC 2.3.1.n7; 1-acylglycerophosphoserine O-acyltransferase MBOAT1; EC 2.3.1.n6; Lysophosphatidylserine acyltransferase; LPSAT; Lyso-PS acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 1; O-acyltransferase domain-containing protein 1
|
|||||
| 3D Structure | ||||||
| Sequence |
MAAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFRIYLRPGTTS
SDVRHAVATIFGIYFVIFCFGWYSVHLFVLVLMCYAIMVTASVSNIHRYSFFVAMGYLTI CHISRIYIFHYGILTTDFSGPLMIVTQKITTLAFQVHDGLGRRAEDLSAEQHRLAIKVKP SFLEYLSYLLNFMSVIAGPCNNFKDYIAFIEGKHIHMKLLEVNWKRKGFHSLPEPSPTGA VIHKLGITLVSLLLFLTLTKTFPVTCLVDDWFVHKASFPARLCYLYVVMQASKPKYYFAW TLADAVNNAAGFGFSGVDKNGNFCWDLLSNLNIWKIETATSFKMYLENWNIQTATWLKCV CYQRVPWYPTVLTFILSALWHGVYPGYYFTFLTGILVTLAARAVRNNYRHYFLSSRALKA VYDAGTWAVTQLAVSYTVAPFVMLAVEPTISLYKSMYFYLHIISLLIILFLPMKPQAHTQ RRPQTLNSINKRKTD |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Membrane-bound acyltransferase family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Acyltransferase which catalyzes the transfer of an acyl group from an acyl-CoA towards a lysophospholipid producing a phospholipid and participates in the reacylation step of the phospholipid remodeling pathway also known as the Lands cycle. Acts on lysophosphatidylserine (1-acyl-2-hydroxy-sn-glycero-3-phospho-L-serine or LPS) and lysophosphatidylethanolamine (1-acyl-sn-glycero-3-phosphoethanolamine or LPE), and to a lesser extend lysophosphatidylcholine. Prefers oleoyl-CoA as the acyl donor and 1-oleoyl-LPE as acceptor. May play a role in neurite outgrowth during neuronal differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C266(1.08) | LDD1513 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0270 | AC15 | HEK-293T | C266(1.08) | LDD1513 | [1] |
| LDCM0283 | AC23 | HEK-293T | C266(0.92) | LDD1522 | [1] |
| LDCM0292 | AC31 | HEK-293T | C266(1.04) | LDD1531 | [1] |
| LDCM0300 | AC39 | HEK-293T | C266(0.98) | LDD1539 | [1] |
| LDCM0309 | AC47 | HEK-293T | C266(0.87) | LDD1548 | [1] |
| LDCM0318 | AC55 | HEK-293T | C266(0.94) | LDD1557 | [1] |
| LDCM0327 | AC63 | HEK-293T | C266(0.98) | LDD1566 | [1] |
| LDCM0334 | AC7 | HEK-293T | C266(0.96) | LDD1568 | [1] |
| LDCM0379 | CL11 | HEK-293T | C266(1.14) | LDD1583 | [1] |
| LDCM0411 | CL23 | HEK-293T | C266(1.01) | LDD1615 | [1] |
| LDCM0424 | CL35 | HEK-293T | C266(1.00) | LDD1628 | [1] |
| LDCM0437 | CL47 | HEK-293T | C266(1.20) | LDD1641 | [1] |
| LDCM0450 | CL59 | HEK-293T | C266(0.99) | LDD1653 | [1] |
| LDCM0464 | CL71 | HEK-293T | C266(1.09) | LDD1667 | [1] |
| LDCM0477 | CL83 | HEK-293T | C266(1.10) | LDD1680 | [1] |
| LDCM0490 | CL95 | HEK-293T | C266(1.00) | LDD1693 | [1] |

