Details of the Target

General Information of Target

Target ID LDTP07709
Target Name Protein disulfide isomerase CRELD2 (CRELD2)
Gene Name CRELD2
Gene ID 79174
Synonyms
Protein disulfide isomerase CRELD2; EC 5.3.4.1; Cysteine-rich with EGF-like domain protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPP
CSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECSLAEKT
CVRKNENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDL
Target Bioclass
Enzyme
Family
CRELD family
Subcellular location
Endoplasmic reticulum
Function Protein disulfide isomerase. Might play a role in the unfolded protein response. May regulate transport of alpha4-beta2 neuronal acetylcholine receptor.
Uniprot ID
Q6UXH1
Ensemble ID
ENST00000328268.9
HGNC ID
HGNC:28150

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
22RV1 Substitution: p.S295A DBIA    Probe Info 
CAL120 Substitution: p.S295A .
HDQP1 SNV: p.V264L DBIA    Probe Info 
HELA Substitution: p.S295A .
LS123 Substitution: p.S295A .
OVTOKO SNV: p.C319S DBIA    Probe Info 
RH41 Substitution: p.S295A DBIA    Probe Info 
WM793 SNV: p.A297P DBIA    Probe Info 

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C255(1.07)  LDD3312  [1]
5E-2FA
 Probe Info  		N.A.  LDD2235  [2]
m-APA
 Probe Info  		N.A.  LDD2232  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [3]
IA-alkyne
 Probe Info  		C277(0.00); C288(0.00)  LDD0032  [4]
Lodoacetamide azide
 Probe Info  		C120(0.00); C206(0.00)  LDD0037  [3]
IPM
 Probe Info  		C294(0.00); C288(0.00)  LDD2156  [5]
NAIA_5
 Probe Info  		C31(0.00); C120(0.00)  LDD2223  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C34(1.24)  LDD2187  [7]
 LDCM0572  Fragment10 Ramos C34(3.26)  LDD2189  [7]
 LDCM0573  Fragment11 Ramos C34(0.02)  LDD2190  [7]
 LDCM0574  Fragment12 Ramos C34(3.49)  LDD2191  [7]
 LDCM0575  Fragment13 Ramos C34(1.01)  LDD2192  [7]
 LDCM0576  Fragment14 Ramos C34(0.54)  LDD2193  [7]
 LDCM0579  Fragment20 Ramos C34(7.27)  LDD2194  [7]
 LDCM0580  Fragment21 Ramos C34(0.99)  LDD2195  [7]
 LDCM0582  Fragment23 Ramos C34(1.81)  LDD2196  [7]
 LDCM0578  Fragment27 Ramos C34(1.55)  LDD2197  [7]
 LDCM0586  Fragment28 Ramos C34(3.08)  LDD2198  [7]
 LDCM0588  Fragment30 Ramos C34(1.68)  LDD2199  [7]
 LDCM0589  Fragment31 Ramos C34(1.08)  LDD2200  [7]
 LDCM0590  Fragment32 Ramos C34(4.55)  LDD2201  [7]
 LDCM0468  Fragment33 Ramos C34(1.25)  LDD2202  [7]
 LDCM0596  Fragment38 Ramos C34(1.71)  LDD2203  [7]
 LDCM0566  Fragment4 Ramos C34(2.04)  LDD2184  [7]
 LDCM0610  Fragment52 Ramos C34(1.78)  LDD2204  [7]
 LDCM0614  Fragment56 Ramos C34(2.47)  LDD2205  [7]
 LDCM0569  Fragment7 Ramos C34(2.53)  LDD2186  [7]
 LDCM0571  Fragment9 Ramos C34(5.28)  LDD2188  [7]
 LDCM0022  KB02 Ramos C34(2.94)  LDD2182  [7]
 LDCM0023  KB03 Ramos C34(2.61)  LDD2183  [7]
 LDCM0024  KB05 HMCB C255(1.07)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (DLST) 2-oxoacid dehydrogenase family P36957
Serine/threonine-protein kinase Nek7 (NEK7) NEK Ser/Thr protein kinase family Q8TDX7
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calreticulin (CALR) Calreticulin family P27797
Huntingtin (HTT) Huntingtin family P42858
Neuronal acetylcholine receptor subunit alpha-4 (CHRNA4) Ligand-gated ion channel family P43681
Cadherin-1 (CDH1) . P12830
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclin-dependent kinase inhibitor 2A (CDKN2A) CDKN2 cyclin-dependent kinase inhibitor family P42771
Cyclin-dependent kinase 5 activator 1 (CDK5R1) Cyclin-dependent kinase 5 activator family Q15078
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
6 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578