Details of the Target
General Information of Target
| Target ID | LDTP07566 | |||||
|---|---|---|---|---|---|---|
| Target Name | Keratin-associated protein 26-1 (KRTAP26-1) | |||||
| Gene Name | KRTAP26-1 | |||||
| Gene ID | 388818 | |||||
| Synonyms |
KAP26.1; Keratin-associated protein 26-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETC
GEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSS GCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVS SSLRPLGPLFSGCQPLTHVFSTCRPSCSGL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
PMG family
|
|||||
| Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C122(1.94) | LDD2182 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C122(0.86) | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | C122(0.84) | LDD2189 | [1] |
| LDCM0573 | Fragment11 | Ramos | C122(0.02) | LDD2190 | [1] |
| LDCM0574 | Fragment12 | Ramos | C122(0.58) | LDD2191 | [1] |
| LDCM0575 | Fragment13 | Ramos | C122(0.52) | LDD2192 | [1] |
| LDCM0576 | Fragment14 | Ramos | C122(0.58) | LDD2193 | [1] |
| LDCM0579 | Fragment20 | Ramos | C122(1.48) | LDD2194 | [1] |
| LDCM0580 | Fragment21 | Ramos | C122(0.85) | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | C122(0.96) | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | C122(0.67) | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | C122(0.45) | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C122(1.32) | LDD2199 | [1] |
| LDCM0589 | Fragment31 | Ramos | C122(0.58) | LDD2200 | [1] |
| LDCM0590 | Fragment32 | Ramos | C122(0.33) | LDD2201 | [1] |
| LDCM0468 | Fragment33 | Ramos | C122(1.16) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C122(0.71) | LDD2203 | [1] |
| LDCM0566 | Fragment4 | Ramos | C122(0.59) | LDD2184 | [1] |
| LDCM0610 | Fragment52 | Ramos | C122(0.95) | LDD2204 | [1] |
| LDCM0614 | Fragment56 | Ramos | C122(6.88) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C122(1.26) | LDD2186 | [1] |
| LDCM0571 | Fragment9 | Ramos | C122(1.53) | LDD2188 | [1] |
| LDCM0022 | KB02 | Ramos | C122(1.94) | LDD2182 | [1] |
| LDCM0023 | KB03 | Ramos | C122(0.32) | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | C122(1.66) | LDD2185 | [1] |