Details of the Target
General Information of Target
| Target ID | LDTP07494 | |||||
|---|---|---|---|---|---|---|
| Target Name | Fanconi anemia core complex-associated protein 20 (FAAP20) | |||||
| Gene Name | FAAP20 | |||||
| Gene ID | 199990 | |||||
| Synonyms |
C1orf86; Fanconi anemia core complex-associated protein 20; FANCA-associated protein of 20 kDa; Fanconi anemia-associated protein of 20 kDa |
|||||
| 3D Structure | ||||||
| Sequence |
MEAARRPRLGLSRRRPRPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSL
PAFPGQEPRCGPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQ RPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C70(1.48) | LDD2183 | [1] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0025 | [2] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [3] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0576 | Fragment14 | Ramos | C70(1.01) | LDD2193 | [1] |
| LDCM0586 | Fragment28 | Ramos | C70(0.86) | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C70(0.55) | LDD2199 | [1] |
| LDCM0468 | Fragment33 | Ramos | C70(0.57) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C70(1.01) | LDD2203 | [1] |
| LDCM0614 | Fragment56 | Ramos | C70(0.72) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C70(1.74) | LDD2186 | [1] |
| LDCM0571 | Fragment9 | Ramos | C70(0.83) | LDD2188 | [1] |
| LDCM0023 | KB03 | Ramos | C70(1.48) | LDD2183 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Alpha-crystallin A chain (CRYAA) | Small heat shock protein (HSP20) family | P02489 | |||
Transcription factor
Other
References




