Details of the Target

General Information of Target

Target ID LDTP07494
Target Name Fanconi anemia core complex-associated protein 20 (FAAP20)
Gene Name FAAP20
Gene ID 199990
Synonyms
C1orf86; Fanconi anemia core complex-associated protein 20; FANCA-associated protein of 20 kDa; Fanconi anemia-associated protein of 20 kDa
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEAARRPRLGLSRRRPRPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSL
PAFPGQEPRCGPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQ
RPAPDPCRAPRVEQQPSVEGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW
Target Bioclass
Other
Subcellular location
Nucleus
Function
Component of the Fanconi anemia (FA) complex required to recruit the FA complex to DNA interstrand cross-links (ICLs) and promote ICLs repair. Following DNA damage recognizes and binds 'Lys-63'-linked ubiquitin generated by RNF8 at ICLs and recruits other components of the FA complex. Promotes translesion synthesis via interaction with REV1.
Uniprot ID
Q6NZ36
Ensemble ID
ENST00000378543.2
HGNC ID
HGNC:26428

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
NALM6 SNV: p.V178M .
NCIH1993 SNV: p.T159N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C70(1.48)  LDD2183  [1]
IPM
 Probe Info  		N.A.  LDD0025  [2]
NAIA_4
 Probe Info  		N.A.  LDD2226  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0576  Fragment14 Ramos C70(1.01)  LDD2193  [1]
 LDCM0586  Fragment28 Ramos C70(0.86)  LDD2198  [1]
 LDCM0588  Fragment30 Ramos C70(0.55)  LDD2199  [1]
 LDCM0468  Fragment33 Ramos C70(0.57)  LDD2202  [1]
 LDCM0596  Fragment38 Ramos C70(1.01)  LDD2203  [1]
 LDCM0614  Fragment56 Ramos C70(0.72)  LDD2205  [1]
 LDCM0569  Fragment7 Ramos C70(1.74)  LDD2186  [1]
 LDCM0571  Fragment9 Ramos C70(0.83)  LDD2188  [1]
 LDCM0023  KB03 Ramos C70(1.48)  LDD2183  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA repair protein REV1 (REV1) DNA polymerase type-Y family Q9UBZ9
Kallikrein-6 (KLK6) Peptidase S1 family Q92876
Tribbles homolog 3 (TRIB3) CAMK Ser/Thr protein kinase family Q96RU7
Serine/threonine-protein kinase PAK 1 (PAK1) STE Ser/Thr protein kinase family Q13153
Dual specificity protein phosphatase 21 (DUSP21) Protein-tyrosine phosphatase family Q9H596
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 (CTDSP1) . Q9GZU7
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-crystallin A chain (CRYAA) Small heat shock protein (HSP20) family P02489
Transcription factor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Cone-rod homeobox protein (CRX) Paired homeobox family O43186
Aryl hydrocarbon receptor nuclear translocator 2 (ARNT2) . Q9HBZ2
Other
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
BPI fold-containing family A member 1 (BPIFA1) Plunc family Q9NP55
Neutrophil gelatinase-associated lipocalin (LCN2) Lipocalin family P80188
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
MOB kinase activator 2 (MOB2) MOB1/phocein family Q70IA6
Prefoldin subunit 5 (PFDN5) Prefoldin subunit alpha family Q99471
Cancer/testis antigen 55 (CT55) . Q8WUE5
Fanconi anemia group A protein (FANCA) . O15360
LRP2-binding protein (LRP2BP) . Q9P2M1
SERTA domain-containing protein 1 (SERTAD1) . Q9UHV2
SERTA domain-containing protein 3 (SERTAD3) . Q9UJW9

References

1 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264