Details of the Target
General Information of Target
Target ID | LDTP07480 | |||||
---|---|---|---|---|---|---|
Target Name | Major facilitator superfamily domain-containing protein 12 (MFSD12) | |||||
Gene Name | MFSD12 | |||||
Gene ID | 126321 | |||||
Synonyms |
C19orf28; Major facilitator superfamily domain-containing protein 12 |
|||||
3D Structure | ||||||
Sequence |
MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSVRAYSSRGAGL
LLLLGQVADGLCTPLVGYEADRAASCCARYGPRKAWHLVGTVCVLLSFPFIFSPCLGCGA ATPEWAALLYYGPFIVIFQFGWASTQISHLSLIPELVTNDHEKVELTALRYAFTVVANIT VYGAAWLLLHLQGSSRVEPTQDISISDQLGGQDVPVFRNLSLLVVGVGAVFSLLFHLGTR ERRRPHAEEPGEHTPLLAPATAQPLLLWKHWLREPAFYQVGILYMTTRLIVNLSQTYMAM YLTYSLHLPKKFIATIPLVMYLSGFLSSFLMKPINKCIGRNMTYFSGLLVILAFAAWVAL AEGLGVAVYAAAVLLGAGCATILVTSLAMTADLIGPHTNSGAFVYGSMSFLDKVANGLAV MAIQSLHPCPSELCCRACVSFYHWAMVAVTGGVGVAAALCLCSLLLWPTRLRRWDRDARP |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Major facilitator superfamily
|
|||||
Subcellular location |
Melanosome membrane
|
|||||
Function |
Transporter that mediates the import of cysteine into melanosomes, thereby regulating skin pigmentation. In melanosomes, cysteine import is required both for normal levels of cystine, the oxidized dimer of cysteine, and provide cysteine for the production of the cysteinyldopas used in pheomelanin synthesis, thereby regulating skin pigmentation. Also catalyzes import of cysteine into lysosomes in non-pigmented cells, regulating lysosomal cystine and cysteine storage, which is essnetial for redox homeostasis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
BTD Probe Info |
![]() |
C87(0.91) | LDD2101 | [1] | |
IPM Probe Info |
![]() |
C87(32.96) | LDD1701 | [1] | |
DBIA Probe Info |
![]() |
C87(0.84) | LDD1508 | [2] | |
Crotonaldehyde Probe Info |
![]() |
N.A. | LDD0219 | [3] |
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
BD-F Probe Info |
![]() |
V214(0.00); S206(0.00) | LDD0024 | [4] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0215 | AC10 | HEK-293T | C87(0.84) | LDD1508 | [2] |
LDCM0277 | AC18 | HEK-293T | C87(1.01) | LDD1516 | [2] |
LDCM0279 | AC2 | HEK-293T | C87(1.20) | LDD1518 | [2] |
LDCM0281 | AC21 | HEK-293T | C87(0.80) | LDD1520 | [2] |
LDCM0286 | AC26 | HEK-293T | C87(0.83) | LDD1525 | [2] |
LDCM0289 | AC29 | HEK-293T | C87(0.91) | LDD1528 | [2] |
LDCM0295 | AC34 | HEK-293T | C87(1.01) | LDD1534 | [2] |
LDCM0298 | AC37 | HEK-293T | C87(0.81) | LDD1537 | [2] |
LDCM0304 | AC42 | HEK-293T | C87(0.82) | LDD1543 | [2] |
LDCM0307 | AC45 | HEK-293T | C87(0.90) | LDD1546 | [2] |
LDCM0312 | AC5 | HEK-293T | C87(0.86) | LDD1551 | [2] |
LDCM0313 | AC50 | HEK-293T | C87(0.66) | LDD1552 | [2] |
LDCM0316 | AC53 | HEK-293T | C87(0.90) | LDD1555 | [2] |
LDCM0321 | AC58 | HEK-293T | C87(0.99) | LDD1560 | [2] |
LDCM0325 | AC61 | HEK-293T | C87(1.00) | LDD1564 | [2] |
LDCM0248 | AKOS034007472 | HEK-293T | C87(1.17) | LDD1511 | [2] |
LDCM0405 | CL18 | HEK-293T | C87(1.14) | LDD1609 | [2] |
LDCM0409 | CL21 | HEK-293T | C87(1.01) | LDD1613 | [2] |
LDCM0419 | CL30 | HEK-293T | C87(0.87) | LDD1623 | [2] |
LDCM0422 | CL33 | HEK-293T | C87(1.52) | LDD1626 | [2] |
LDCM0432 | CL42 | HEK-293T | C87(0.76) | LDD1636 | [2] |
LDCM0435 | CL45 | HEK-293T | C87(1.19) | LDD1639 | [2] |
LDCM0445 | CL54 | HEK-293T | C87(2.00) | LDD1648 | [2] |
LDCM0448 | CL57 | HEK-293T | C87(1.36) | LDD1651 | [2] |
LDCM0451 | CL6 | HEK-293T | C87(1.18) | LDD1654 | [2] |
LDCM0458 | CL66 | HEK-293T | C87(0.92) | LDD1661 | [2] |
LDCM0461 | CL69 | HEK-293T | C87(1.13) | LDD1664 | [2] |
LDCM0471 | CL78 | HEK-293T | C87(1.19) | LDD1674 | [2] |
LDCM0475 | CL81 | HEK-293T | C87(1.16) | LDD1678 | [2] |
LDCM0484 | CL9 | HEK-293T | C87(1.24) | LDD1687 | [2] |
LDCM0485 | CL90 | HEK-293T | C87(2.25) | LDD1688 | [2] |
LDCM0488 | CL93 | HEK-293T | C87(1.37) | LDD1691 | [2] |
LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C87(28.53) | LDD1702 | [1] |
LDCM0023 | KB03 | MDA-MB-231 | C87(32.96) | LDD1701 | [1] |
LDCM0508 | Nucleophilic fragment 17a | MDA-MB-231 | C87(0.91) | LDD2101 | [1] |
LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C87(0.17) | LDD2109 | [1] |
LDCM0532 | Nucleophilic fragment 29a | MDA-MB-231 | C86(0.48) | LDD2125 | [1] |
LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C87(0.28) | LDD2136 | [1] |
LDCM0554 | Nucleophilic fragment 7a | MDA-MB-231 | C87(0.72) | LDD2148 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Transmembrane protein 14B (TMEM14B) | TMEM14 family | Q9NUH8 |
Immunoglobulin
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
B-cell antigen receptor complex-associated protein alpha chain (CD79A) | . | P11912 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Serine-rich single-pass membrane protein 1 (SSMEM1) | . | Q8WWF3 |
References