Details of the Target
General Information of Target
Target ID | LDTP07434 | |||||
---|---|---|---|---|---|---|
Target Name | CapZ-interacting protein (RCSD1) | |||||
Gene Name | RCSD1 | |||||
Gene ID | 92241 | |||||
Synonyms |
CAPZIP; CapZ-interacting protein; Protein kinase substrate CapZIP; RCSD domain-containing protein 1 |
|||||
3D Structure | ||||||
Sequence |
MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDL
GQNGEEKSPPNASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHS PPSTPSSPGVRSRPSEAEEVPVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSD CGELGDFRAVESSQQNGAKEEDGDEVLPSKSKAPGSPLSSEGAAGEGVRTLGPAEKPPLR RSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEEVPESPQTSGPEAENRCGSPR EEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPHSPPGGVKGGD VPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM |
|||||
Target Bioclass |
Other
|
|||||
Function | Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly. | |||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K88(7.02) | LDD2218 | [1] | |
DBIA Probe Info |
![]() |
C181(1.38) | LDD3333 | [2] | |
N1 Probe Info |
![]() |
N.A. | LDD0245 | [3] | |
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
C155(0.00); C181(0.00); C49(0.00) | LDD0038 | [4] | |
IA-alkyne Probe Info |
![]() |
C155(0.00); C181(0.00); C49(0.00) | LDD0036 | [4] | |
IPIAA_L Probe Info |
![]() |
C181(0.00); C155(0.00) | LDD0031 | [5] | |
Lodoacetamide azide Probe Info |
![]() |
C155(0.00); C181(0.00); C49(0.00) | LDD0037 | [4] | |
Compound 10 Probe Info |
![]() |
C155(0.00); C181(0.00); C49(0.00) | LDD2216 | [6] | |
Compound 11 Probe Info |
![]() |
C155(0.00); C181(0.00) | LDD2213 | [6] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0625 | F8 | Ramos | C181(2.19); C155(2.73) | LDD2187 | [7] |
LDCM0572 | Fragment10 | Ramos | C181(2.44); C155(20.00) | LDD2189 | [7] |
LDCM0573 | Fragment11 | Ramos | C181(1.96); C155(0.06) | LDD2190 | [7] |
LDCM0574 | Fragment12 | Ramos | C181(0.67); C155(0.69) | LDD2191 | [7] |
LDCM0575 | Fragment13 | Ramos | C181(1.18); C155(1.26) | LDD2192 | [7] |
LDCM0576 | Fragment14 | Ramos | C181(0.67); C155(0.69) | LDD2193 | [7] |
LDCM0579 | Fragment20 | Ramos | C181(0.78); C155(0.51) | LDD2194 | [7] |
LDCM0580 | Fragment21 | Ramos | C181(1.12); C155(1.28) | LDD2195 | [7] |
LDCM0582 | Fragment23 | Ramos | C181(1.45); C155(1.35) | LDD2196 | [7] |
LDCM0578 | Fragment27 | Ramos | C181(1.45); C155(1.64) | LDD2197 | [7] |
LDCM0586 | Fragment28 | Ramos | C181(1.05); C155(0.73) | LDD2198 | [7] |
LDCM0588 | Fragment30 | Ramos | C181(1.34); C155(1.29) | LDD2199 | [7] |
LDCM0589 | Fragment31 | Ramos | C181(1.22); C155(1.12) | LDD2200 | [7] |
LDCM0590 | Fragment32 | Ramos | C181(1.03); C155(0.79) | LDD2201 | [7] |
LDCM0468 | Fragment33 | Ramos | C181(1.67); C155(6.14) | LDD2202 | [7] |
LDCM0596 | Fragment38 | Ramos | C181(0.93); C155(1.12) | LDD2203 | [7] |
LDCM0566 | Fragment4 | Ramos | C181(1.03); C155(0.91) | LDD2184 | [7] |
LDCM0610 | Fragment52 | Ramos | C181(1.36); C155(1.21) | LDD2204 | [7] |
LDCM0614 | Fragment56 | Ramos | C181(1.50); C155(1.35) | LDD2205 | [7] |
LDCM0569 | Fragment7 | Ramos | C181(1.92); C155(0.72) | LDD2186 | [7] |
LDCM0571 | Fragment9 | Ramos | C181(1.53); C155(1.00) | LDD2188 | [7] |
LDCM0022 | KB02 | T cell | C181(11.90) | LDD1707 | [8] |
LDCM0023 | KB03 | Ramos | C181(1.05); C155(0.74) | LDD2183 | [7] |
LDCM0024 | KB05 | MOLM-13 | C181(1.38) | LDD3333 | [2] |
LDCM0131 | RA190 | MM1.R | C181(1.73); C381(1.35); C155(1.11) | LDD0304 | [9] |
References