Details of the Target

General Information of Target

Target ID LDTP06953
Target Name TPA-induced transmembrane protein (TTMP)
Gene Name TTMP
Gene ID 79669
Synonyms
C3orf52; TPA-induced transmembrane protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDLAQPSQPVDELELSVLERQPEENTPLNGADKVFPSLDEEVPPAEANKESPWSSCNKNV
VGRCKLWMIITSIFLGVITVIIIGLCLAAVTYVDEDENEILELSSNKTFFIMLKIPEECV
AEEELPHLLTERLTDVYSTSPSLGRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKY
MMSEELVLGILLQDFRDQNIPGCESLGLDPTSLLLYE
Target Bioclass
Other
Subcellular location
Endoplasmic reticulum membrane
Function
Has a role in LIPH-mediated synthesis of 2-acyl lysophosphatidic acid (LPA). LPA is a bioactive lipid mediator involved in different biological processes, and necessary to promote hair formation and growth.
Uniprot ID
Q5BVD1
Ensemble ID
ENST00000264848.10
HGNC ID
HGNC:26255

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
COLO320 SNV: p.P22A .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C119(1.26)  LDD1507  [1]
IPM
 Probe Info  		N.A.  LDD2156  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C119(1.26)  LDD1507  [1]
 LDCM0237  AC12 HEK-293T C119(0.98)  LDD1510  [1]
 LDCM0276  AC17 HEK-293T C119(1.11)  LDD1515  [1]
 LDCM0280  AC20 HEK-293T C119(0.92)  LDD1519  [1]
 LDCM0285  AC25 HEK-293T C119(1.13)  LDD1524  [1]
 LDCM0288  AC28 HEK-293T C119(0.89)  LDD1527  [1]
 LDCM0294  AC33 HEK-293T C119(1.13)  LDD1533  [1]
 LDCM0297  AC36 HEK-293T C119(0.93)  LDD1536  [1]
 LDCM0301  AC4 HEK-293T C119(0.96)  LDD1540  [1]
 LDCM0303  AC41 HEK-293T C119(0.98)  LDD1542  [1]
 LDCM0306  AC44 HEK-293T C119(1.04)  LDD1545  [1]
 LDCM0311  AC49 HEK-293T C119(1.24)  LDD1550  [1]
 LDCM0315  AC52 HEK-293T C119(0.86)  LDD1554  [1]
 LDCM0320  AC57 HEK-293T C119(1.07)  LDD1559  [1]
 LDCM0324  AC60 HEK-293T C119(0.99)  LDD1563  [1]
 LDCM0356  AKOS034007680 HEK-293T C119(1.14)  LDD1570  [1]
 LDCM0404  CL17 HEK-293T C119(1.10)  LDD1608  [1]
 LDCM0408  CL20 HEK-293T C119(0.98)  LDD1612  [1]
 LDCM0417  CL29 HEK-293T C119(1.05)  LDD1621  [1]
 LDCM0421  CL32 HEK-293T C119(0.93)  LDD1625  [1]
 LDCM0431  CL41 HEK-293T C119(1.05)  LDD1635  [1]
 LDCM0434  CL44 HEK-293T C119(0.94)  LDD1638  [1]
 LDCM0440  CL5 HEK-293T C119(1.02)  LDD1644  [1]
 LDCM0444  CL53 HEK-293T C119(1.02)  LDD1647  [1]
 LDCM0447  CL56 HEK-293T C119(0.91)  LDD1650  [1]
 LDCM0457  CL65 HEK-293T C119(1.06)  LDD1660  [1]
 LDCM0460  CL68 HEK-293T C119(0.90)  LDD1663  [1]
 LDCM0470  CL77 HEK-293T C119(1.18)  LDD1673  [1]
 LDCM0473  CL8 HEK-293T C119(0.96)  LDD1676  [1]
 LDCM0474  CL80 HEK-293T C119(0.88)  LDD1677  [1]
 LDCM0483  CL89 HEK-293T C119(1.07)  LDD1686  [1]
 LDCM0487  CL92 HEK-293T C119(0.86)  LDD1690  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 (FUT3) Glycosyltransferase 10 family P21217
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3 (ST6GALNAC3) Glycosyltransferase 29 family Q8NDV1
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Microsomal glutathione S-transferase 2 (MGST2) MAPEG family Q99735
Kell blood group glycoprotein (KEL) Peptidase M13 family P23276
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
Carbohydrate sulfotransferase 13 (CHST13) Sulfotransferase 2 family Q8NET6
Protein ATP1B4 (ATP1B4) X(+)/potassium ATPases subunit beta family Q9UN42
E3 ubiquitin-protein ligase ZNRF3 (ZNRF3) ZNRF3 family Q9ULT6
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Stomatin (STOM) Band 7/mec-2 family P27105
Ileal sodium/bile acid cotransporter (SLC10A2) Bile acid:sodium symporter (BASS) family Q12908
Claudin-7 (CLDN7) Claudin family O95471
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Gap junction beta-1 protein (GJB1) Connexin family P08034
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Transmembrane protein 179B (TMEM179B) TMEM179 family Q7Z7N9
Uroplakin-2 (UPK2) Uroplakin-2 family O00526
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Paired-like homeodomain transcription factor LEUTX (LEUTX) Paired homeobox family A8MZ59
GPCR
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
Mas-related G-protein coupled receptor member X3 (MRGPRX3) G-protein coupled receptor 1 family Q96LB0
Adhesion G protein-coupled receptor G3 (ADGRG3) G-protein coupled receptor 2 family Q86Y34
Immunoglobulin
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Amphoterin-induced protein 1 (AMIGO1) AMIGO family Q86WK6
Myeloid cell surface antigen CD33 (CD33) SIGLEC (sialic acid binding Ig-like lectin) family P20138
Poliovirus receptor (PVR) Nectin family P15151
Advanced glycosylation end product-specific receptor (AGER) . Q15109
Endothelial cell-selective adhesion molecule (ESAM) . Q96AP7
HERV-H LTR-associating protein 2 (HHLA2) . Q9UM44
Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1) . Q68D85
Cytokine and receptor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 21 (CCL21) Intercrine beta (chemokine CC) family O00585
C-C motif chemokine 26 (CCL26) Intercrine beta (chemokine CC) family Q9Y258
Other
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Dexamethasone-induced protein (DEXI) DEXI family O95424
Receptor expression-enhancing protein 3 (REEP3) DP1 family Q6NUK4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Nesprin-4 (SYNE4) Nesprin family Q8N205
Neural proliferation differentiation and control protein 1 (NPDC1) NPDC1/cab-1 family Q9NQX5
Neuronal vesicle trafficking-associated protein 2 (NSG2) NSG family Q9Y328
Small glutamine-rich tetratricopeptide repeat-containing protein alpha (SGTA) SGT family O43765
SREBP regulating gene protein (SPRING1) SPRING family Q9H741
Complex I assembly factor TIMMDC1, mitochondrial (TIMMDC1) Tim17/Tim22/Tim23 family Q9NPL8
Transmembrane protein 45B (TMEM45B) TMEM45 family Q96B21
Bcl-2-interacting killer (BIK) . Q13323
C-type lectin domain family 10 member A (CLEC10A) . Q8IUN9
Endoplasmic reticulum resident protein 29 (ERP29) . P30040
Fibronectin type III domain-containing protein 9 (FNDC9) . Q8TBE3
Leucine-rich repeat-containing protein 25 (LRRC25) . Q8N386
NKG2-A/NKG2-B type II integral membrane protein (KLRC1) . P26715
SIGLEC family-like protein 1 (SIGLECL1) . Q8N7X8
Transmembrane protein 52B (TMEM52B) . Q4KMG9
Transmembrane protein 80 (TMEM80) . Q96HE8

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019