Details of the Target
General Information of Target
| Target ID | LDTP06876 | |||||
|---|---|---|---|---|---|---|
| Target Name | Extracellular tyrosine-protein kinase PKDCC (PKDCC) | |||||
| Gene Name | PKDCC | |||||
| Gene ID | 91461 | |||||
| Synonyms |
SGK493; VLK; Extracellular tyrosine-protein kinase PKDCC; EC 2.7.10.2; Protein kinase domain-containing protein, cytoplasmic; Protein kinase-like protein SgK493; Sugen kinase 493; Vertebrate lonesome kinase
|
|||||
| 3D Structure | ||||||
| Sequence |
MRRRRAAVAAGFCASFLLGSVLNVLFAPGSEPPRPGQSPEPSPAPGPGRRGGRGELARQI
RARYEEVQRYSRGGPGPGAGRPERRRLMDLAPGGPGLPRPRPPWARPLSDGAPGWPPAPG PGSPGPGPRLGCAALRNVSGAQYMGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVR EFGVRRGCYRLAAHKLLKEMVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVE MIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDAR VEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSL RPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQE DYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVV PDPNKTTYVKASG |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Secreted tyrosine-protein kinase that mediates phosphorylation of extracellular proteins and endogenous proteins in the secretory pathway, which is essential for patterning at organogenesis stages. Mediates phosphorylation of MMP1, MMP13, MMP14, MMP19 and ERP29. Probably plays a role in platelets: rapidly and quantitatively secreted from platelets in response to stimulation of platelet degranulation. May also have serine/threonine protein kinase activity. Required for longitudinal bone growth through regulation of chondrocyte differentiation. May be indirectly involved in protein transport from the Golgi apparatus to the plasma membrane.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C132(1.41) | LDD1507 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0214 | AC1 | HEK-293T | C132(1.41) | LDD1507 | [1] |
| LDCM0276 | AC17 | HEK-293T | C132(0.89) | LDD1515 | [1] |
| LDCM0285 | AC25 | HEK-293T | C132(1.29) | LDD1524 | [1] |
| LDCM0294 | AC33 | HEK-293T | C132(1.20) | LDD1533 | [1] |
| LDCM0303 | AC41 | HEK-293T | C132(1.02) | LDD1542 | [1] |
| LDCM0311 | AC49 | HEK-293T | C132(1.10) | LDD1550 | [1] |
| LDCM0320 | AC57 | HEK-293T | C132(0.97) | LDD1559 | [1] |
| LDCM0356 | AKOS034007680 | HEK-293T | C132(1.40) | LDD1570 | [1] |
| LDCM0369 | CL100 | HEK-293T | C132(1.26) | LDD1573 | [1] |
| LDCM0373 | CL104 | HEK-293T | C132(0.96) | LDD1577 | [1] |
| LDCM0377 | CL108 | HEK-293T | C132(1.16) | LDD1581 | [1] |
| LDCM0382 | CL112 | HEK-293T | C132(1.06) | LDD1586 | [1] |
| LDCM0386 | CL116 | HEK-293T | C132(0.92) | LDD1590 | [1] |
| LDCM0391 | CL120 | HEK-293T | C132(1.04) | LDD1595 | [1] |
| LDCM0395 | CL124 | HEK-293T | C132(1.37) | LDD1599 | [1] |
| LDCM0399 | CL128 | HEK-293T | C132(0.93) | LDD1603 | [1] |
| LDCM0403 | CL16 | HEK-293T | C132(1.00) | LDD1607 | [1] |
| LDCM0404 | CL17 | HEK-293T | C132(1.20) | LDD1608 | [1] |
| LDCM0416 | CL28 | HEK-293T | C132(0.95) | LDD1620 | [1] |
| LDCM0417 | CL29 | HEK-293T | C132(1.19) | LDD1621 | [1] |
| LDCM0429 | CL4 | HEK-293T | C132(1.55) | LDD1633 | [1] |
| LDCM0430 | CL40 | HEK-293T | C132(1.08) | LDD1634 | [1] |
| LDCM0431 | CL41 | HEK-293T | C132(1.20) | LDD1635 | [1] |
| LDCM0440 | CL5 | HEK-293T | C132(1.20) | LDD1644 | [1] |
| LDCM0443 | CL52 | HEK-293T | C132(1.11) | LDD1646 | [1] |
| LDCM0444 | CL53 | HEK-293T | C132(1.35) | LDD1647 | [1] |
| LDCM0456 | CL64 | HEK-293T | C132(1.16) | LDD1659 | [1] |
| LDCM0457 | CL65 | HEK-293T | C132(1.14) | LDD1660 | [1] |
| LDCM0469 | CL76 | HEK-293T | C132(0.98) | LDD1672 | [1] |
| LDCM0470 | CL77 | HEK-293T | C132(1.55) | LDD1673 | [1] |
| LDCM0482 | CL88 | HEK-293T | C132(1.19) | LDD1685 | [1] |
| LDCM0483 | CL89 | HEK-293T | C132(1.11) | LDD1686 | [1] |

