Details of the Target
General Information of Target
| Target ID | LDTP06596 | |||||
|---|---|---|---|---|---|---|
| Target Name | Melanoma antigen recognized by T-cells 1 (MLANA) |
|
||||
| Gene Name | MLANA | |||||
| Gene ID | 2315 | |||||
| Synonyms |
MART1; Melanoma antigen recognized by T-cells 1; MART-1; Antigen LB39-AA; Antigen SK29-AA; Protein Melan-A |
|||||
| 3D Structure | ||||||
| Sequence |
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C93(1.94); C68(4.92) | LDD3332 | [1] | |
|
AHL-Pu-1 Probe Info |
 |
C74(2.44); C68(2.49) | LDD0171 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0026 | 4SU-RNA+native RNA | DM93 | C74(2.44); C68(2.49) | LDD0171 | [2] |
| LDCM0022 | KB02 | 22RV1 | C74(3.14); C93(1.21); C68(2.84) | LDD2243 | [1] |
| LDCM0023 | KB03 | 22RV1 | C74(6.69); C93(1.14) | LDD2660 | [1] |
| LDCM0024 | KB05 | MKN45 | C93(1.94); C68(4.92) | LDD3332 | [1] |
The Interaction Atlas With This Target
The Drug(s) Related To This Target
Phase 3
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Melanoma Vaccine | Vaccine | D0U9MJ | |||
| Multi-epitope Peptide Melanoma Vaccine | Vaccine | D0P5TG | |||
Phase 2
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Polynoma-1 | Vaccine | D00DSV | |||
| Mkc-1106-mt | . | D0J7MQ | |||
Discontinued
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Melanoma Vaccine (Alvac) | Vaccine | D0C1EO | |||
| F-50040 | . | D07CQJ | |||
References