Details of the Target
General Information of Target
| Target ID | LDTP06591 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nuclear factor interleukin-3-regulated protein (NFIL3) | |||||
| Gene Name | NFIL3 | |||||
| Gene ID | 4783 | |||||
| Synonyms |
E4BP4; IL3BP1; Nuclear factor interleukin-3-regulated protein; E4 promoter-binding protein 4; Interleukin-3 promoter transcriptional activator; Interleukin-3-binding protein 1; Transcriptional activator NF-IL3A
|
|||||
| 3D Structure | ||||||
| Sequence |
MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEGSVGKNKSSAC
RRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELL SLKLKFGLISSTAYAQEIQKLSNSTAVYFQDYQTSKSNVSSFVDEHEPSMVSSSCISVIK HSPQSSLSDVSEVSSVEHTQESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYT ASIYQNYMGNSFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQKLSSPIDMTSK RHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQKELSGKTQNSFKTGVVEMKD SGYKVSDPENLYLKQGIANLSAEVVSLKRLIATQPISASDSG |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, NFIL3 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Acts as a transcriptional regulator that recognizes and binds to the sequence 5'-[GA]TTA[CT]GTAA[CT]-3', a sequence present in many cellular and viral promoters. Represses transcription from promoters with activating transcription factor (ATF) sites. Represses promoter activity in osteoblasts. Represses transcriptional activity of PER1. Represses transcriptional activity of PER2 via the B-site on the promoter. Activates transcription from the interleukin-3 promoter in T-cells. Competes for the same consensus-binding site with PAR DNA-binding factors (DBP, HLF and TEF). Component of the circadian clock that acts as a negative regulator for the circadian expression of PER2 oscillation in the cell-autonomous core clock. Protects pro-B cells from programmed cell death. Represses the transcription of CYP2A5. Positively regulates the expression and activity of CES2 by antagonizing the repressive action of NR1D1 on CES2. Required for the development of natural killer cell precursors.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C175(1.02) | LDD1573 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0369 | CL100 | HEK-293T | C175(1.02) | LDD1573 | [1] |
| LDCM0373 | CL104 | HEK-293T | C175(0.89) | LDD1577 | [1] |
| LDCM0377 | CL108 | HEK-293T | C175(1.04) | LDD1581 | [1] |
| LDCM0382 | CL112 | HEK-293T | C175(0.93) | LDD1586 | [1] |
| LDCM0386 | CL116 | HEK-293T | C175(0.97) | LDD1590 | [1] |
| LDCM0391 | CL120 | HEK-293T | C175(1.20) | LDD1595 | [1] |
| LDCM0395 | CL124 | HEK-293T | C175(0.98) | LDD1599 | [1] |
| LDCM0399 | CL128 | HEK-293T | C175(1.00) | LDD1603 | [1] |
| LDCM0403 | CL16 | HEK-293T | C175(1.12) | LDD1607 | [1] |
| LDCM0416 | CL28 | HEK-293T | C175(0.82) | LDD1620 | [1] |
| LDCM0429 | CL4 | HEK-293T | C175(0.89) | LDD1633 | [1] |
| LDCM0430 | CL40 | HEK-293T | C175(1.03) | LDD1634 | [1] |
| LDCM0443 | CL52 | HEK-293T | C175(0.83) | LDD1646 | [1] |
| LDCM0456 | CL64 | HEK-293T | C175(0.59) | LDD1659 | [1] |
| LDCM0469 | CL76 | HEK-293T | C175(1.16) | LDD1672 | [1] |
| LDCM0482 | CL88 | HEK-293T | C175(1.02) | LDD1685 | [1] |

