Details of the Target

General Information of Target

Target ID LDTP06572
Target Name Extracellular matrix protein 1 (ECM1)
Gene Name ECM1
Gene ID 1893
Synonyms
Extracellular matrix protein 1; Secretory component p85
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHP
DSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSL
QHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQI
CLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEA
MSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQLRACPSHQPDISSGLELPFP
PGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWK
AWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIW
RDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
Target Bioclass
Other
Subcellular location
Secreted, extracellular space, extracellular matrix
Function Involved in endochondral bone formation as negative regulator of bone mineralization. Stimulates the proliferation of endothelial cells and promotes angiogenesis. Inhibits MMP9 proteolytic activity.
Uniprot ID
Q16610
Ensemble ID
ENST00000346569.6
HGNC ID
HGNC:3153

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL72 SNV: p.Q197Ter .
COLO800 SNV: p.T28K .
HCT15 SNV: p.E231Ter .
KYSE510 SNV: p.Q81E .
NUGC3 SNV: p.Q276H .
RVH421 Substitution: p.R163W DBIA    Probe Info 
SCC25 SNV: p.P277S .
SW480 SNV: p.E143K .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C311(2.94)  LDD3401  [1]
AHL-Pu-1
 Probe Info  		C151(12.84)  LDD0170  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C151(12.84)  LDD0170  [2]
 LDCM0026  4SU-RNA+native RNA DM93 C151(2.76)  LDD0171  [2]
 LDCM0022  KB02 A101D C80(1.60)  LDD2250  [1]
 LDCM0023  KB03 A2058 C80(1.39); C272(2.60); C500(2.42); C453(2.63)  LDD2670  [1]
 LDCM0024  KB05 RD C311(2.94)  LDD3401  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Chorion-specific transcription factor GCMb (GCM2) . O75603
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Tumor necrosis factor ligand superfamily member 6 (FASLG) Tumor necrosis factor family P48023
Other
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-3 (ACTN3) Alpha-actinin family Q08043
cAMP-dependent protein kinase type II-beta regulatory subunit (PRKAR2B) CAMP-dependent kinase regulatory chain family P31323
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Inactive peptidyl-prolyl cis-trans isomerase FKBP6 (FKBP6) FKBP6 family O75344
Progranulin (GRN) Granulin family P28799
Keratin-associated protein 5-3 (KRTAP5-3) KRTAP type 5 family Q6L8H2
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Protein lin-7 homolog A (LIN7A) Lin-7 family O14910
Small glutamine-rich tetratricopeptide repeat-containing protein beta (SGTB) SGT family Q96EQ0
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
APOBEC1 complementation factor (A1CF) . Q9NQ94
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
G patch domain and ankyrin repeat-containing protein 1 (GPANK1) . O95872
Kelch-like protein 38 (KLHL38) . Q2WGJ6
LIM domain transcription factor LMO4 (LMO4) . P61968
Sterile alpha motif domain-containing protein 11 (SAMD11) . Q96NU1
Ubiquilin-1 (UBQLN1) . Q9UMX0
Ubiquilin-2 (UBQLN2) . Q9UHD9

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625