Details of the Target
General Information of Target
| Target ID | LDTP06442 | |||||
|---|---|---|---|---|---|---|
| Target Name | Twist-related protein 1 (TWIST1) | |||||
| Gene Name | TWIST1 | |||||
| Gene ID | 7291 | |||||
| Synonyms |
BHLHA38; TWIST; Twist-related protein 1; Class A basic helix-loop-helix protein 38; bHLHa38; H-twist |
|||||
| 3D Structure | ||||||
| Sequence |
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH ERLSYAFSVWRMEGAWSMSASH |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Acts as a transcriptional regulator. Inhibits myogenesis by sequestrating E proteins, inhibiting trans-activation by MEF2, and inhibiting DNA-binding by MYOD1 through physical interaction. This interaction probably involves the basic domains of both proteins. Also represses expression of pro-inflammatory cytokines such as TNFA and IL1B. Regulates cranial suture patterning and fusion. Activates transcription as a heterodimer with E proteins. Regulates gene expression differentially, depending on dimer composition. Homodimers induce expression of FGFR2 and POSTN while heterodimers repress FGFR2 and POSTN expression and induce THBS1 expression. Heterodimerization is also required for osteoblast differentiation. Represses the activity of the circadian transcriptional activator: NPAS2-BMAL1 heterodimer.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C175(2.38) | LDD3433 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0369 | CL100 | HEK-293T | C175(1.72) | LDD1573 | [2] |
| LDCM0373 | CL104 | HEK-293T | C175(1.20) | LDD1577 | [2] |
| LDCM0377 | CL108 | HEK-293T | C175(0.92) | LDD1581 | [2] |
| LDCM0382 | CL112 | HEK-293T | C175(1.01) | LDD1586 | [2] |
| LDCM0386 | CL116 | HEK-293T | C175(0.98) | LDD1590 | [2] |
| LDCM0391 | CL120 | HEK-293T | C175(1.16) | LDD1595 | [2] |
| LDCM0395 | CL124 | HEK-293T | C175(1.08) | LDD1599 | [2] |
| LDCM0399 | CL128 | HEK-293T | C175(1.04) | LDD1603 | [2] |
| LDCM0403 | CL16 | HEK-293T | C175(1.19) | LDD1607 | [2] |
| LDCM0416 | CL28 | HEK-293T | C175(1.10) | LDD1620 | [2] |
| LDCM0429 | CL4 | HEK-293T | C175(1.06) | LDD1633 | [2] |
| LDCM0430 | CL40 | HEK-293T | C175(0.82) | LDD1634 | [2] |
| LDCM0443 | CL52 | HEK-293T | C175(1.41) | LDD1646 | [2] |
| LDCM0456 | CL64 | HEK-293T | C175(1.01) | LDD1659 | [2] |
| LDCM0469 | CL76 | HEK-293T | C175(1.04) | LDD1672 | [2] |
| LDCM0482 | CL88 | HEK-293T | C175(1.15) | LDD1685 | [2] |
| LDCM0022 | KB02 | AGS | C175(1.56) | LDD2263 | [1] |
| LDCM0023 | KB03 | AGS | C81(2.07) | LDD2680 | [1] |
| LDCM0024 | KB05 | SK-N-AS | C175(2.38) | LDD3433 | [1] |
References

