Details of the Target
General Information of Target
| Target ID | LDTP06313 | |||||
|---|---|---|---|---|---|---|
| Target Name | Neutrophil cytosol factor 4 (NCF4) |
|
||||
| Gene Name | NCF4 | |||||
| Gene ID | 4689 | |||||
| Synonyms |
SH3PXD4; Neutrophil cytosol factor 4; NCF-4; Neutrophil NADPH oxidase factor 4; SH3 and PX domain-containing protein 4; p40-phox; p40phox |
|||||
| 3D Structure | ||||||
| Sequence |
MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYR
QFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP VWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFD FTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWL RCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSD EDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Component of the NADPH-oxidase, a multicomponent enzyme system responsible for the oxidative burst in which electrons are transported from NADPH to molecular oxygen, generating reactive oxidant intermediates. It may be important for the assembly and/or activation of the NADPH-oxidase complex.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
 |
K317(0.43) | LDD0274 | [1] | |
|
DBIA Probe Info |
 |
C84(1.98) | LDD3334 | [2] | |
|
IA-alkyne Probe Info |
 |
C84(0.50) | LDD2182 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C84(0.90) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C84(0.56) | LDD2189 | [3] |
| LDCM0573 | Fragment11 | Ramos | C84(7.17) | LDD2190 | [3] |
| LDCM0574 | Fragment12 | Ramos | C84(0.63) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C84(1.14) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C84(0.76) | LDD2193 | [3] |
| LDCM0579 | Fragment20 | Ramos | C84(0.43) | LDD2194 | [3] |
| LDCM0580 | Fragment21 | Ramos | C84(0.80) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C84(0.96) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C84(0.85) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C84(1.34) | LDD2198 | [3] |
| LDCM0588 | Fragment30 | Ramos | C84(1.05) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C84(0.82) | LDD2200 | [3] |
| LDCM0590 | Fragment32 | Ramos | C84(0.62) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C84(0.97) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C84(0.74) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C84(0.68) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C84(1.24) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C84(1.48) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C84(0.55) | LDD2186 | [3] |
| LDCM0571 | Fragment9 | Ramos | C84(0.66) | LDD2188 | [3] |
| LDCM0022 | KB02 | Ramos | C84(0.50) | LDD2182 | [3] |
| LDCM0023 | KB03 | Ramos | C84(0.71) | LDD2183 | [3] |
| LDCM0024 | KB05 | MOLM-16 | C84(1.98) | LDD3334 | [2] |
References