Details of the Target
General Information of Target
| Target ID | LDTP06261 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ataxin-7-like protein 3 (ATXN7L3) | |||||
| Gene Name | ATXN7L3 | |||||
| Synonyms |
Ataxin-7-like protein 3; SAGA-associated factor 11 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MKMEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKD
FEIVDQPGLDIFGQVFNQWKSKECVCPNCSRSIAASRFAPHLEKCLGMGRNSSRIANRRI ANSNNMNKSESDQEDNDDINDNDWSYGSEKKAKKRKSDKNPNSPRRSKSLKHKNGELSNS DPFKYNNSTGISYETLGPEELRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIY FLGPSAVLPEVESSLDNDSFDMTDSQALISRLQWDGSSDLSPSDSGSSKTSENQGWGLGT NSSESRKTKKKKSHLSLVGTASGLGSNKKKKPKPPAPPTPSIYDDIN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SGF11 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Within the complex, it is required to recruit USP22 and ENY2 into the SAGA complex. Regulates H2B monoubiquitination (H2Bub1) levels. Affects subcellular distribution of ENY2, USP22 and ATXN7L3B. {|HAMAP-Rule:MF_03047}.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C226(5.13) | LDD0205 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0226 | AC11 | HEK-293T | C45(0.98) | LDD1509 | [2] |
| LDCM0278 | AC19 | HEK-293T | C45(0.99) | LDD1517 | [2] |
| LDCM0287 | AC27 | HEK-293T | C45(1.10) | LDD1526 | [2] |
| LDCM0290 | AC3 | HEK-293T | C45(1.08) | LDD1529 | [2] |
| LDCM0296 | AC35 | HEK-293T | C45(0.93) | LDD1535 | [2] |
| LDCM0305 | AC43 | HEK-293T | C45(1.14) | LDD1544 | [2] |
| LDCM0314 | AC51 | HEK-293T | C45(0.94) | LDD1553 | [2] |
| LDCM0322 | AC59 | HEK-293T | C45(1.07) | LDD1561 | [2] |
| LDCM0103 | BDHI 10 | Jurkat | C226(5.13) | LDD0205 | [1] |
| LDCM0406 | CL19 | HEK-293T | C45(1.20) | LDD1610 | [2] |
| LDCM0420 | CL31 | HEK-293T | C45(0.96) | LDD1624 | [2] |
| LDCM0433 | CL43 | HEK-293T | C45(0.86) | LDD1637 | [2] |
| LDCM0446 | CL55 | HEK-293T | C45(0.80) | LDD1649 | [2] |
| LDCM0459 | CL67 | HEK-293T | C45(0.97) | LDD1662 | [2] |
| LDCM0462 | CL7 | HEK-293T | C45(0.98) | LDD1665 | [2] |
| LDCM0472 | CL79 | HEK-293T | C45(0.84) | LDD1675 | [2] |
| LDCM0486 | CL91 | HEK-293T | C45(1.08) | LDD1689 | [2] |
| LDCM0022 | KB02 | 786-O | C233(1.27) | LDD2247 | [3] |
| LDCM0023 | KB03 | A2058 | C233(1.35) | LDD2670 | [3] |
| LDCM0024 | KB05 | MOLM-13 | C233(0.99) | LDD3333 | [3] |
The Interaction Atlas With This Target
References

